0102030405060708090
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLP
100110120130140150160170180190
NLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSE
200210220230240250260270280290
DCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
1
300310320330340350360370380390
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQ
400410420430440450460470480490
SWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVC
500510520530540550560570580590
DPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
600610620630640650660670680690
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVL
1
700710720730740750760770780790
ARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVR
800810820830840850860870880890
QHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
900910920930940950960970980990
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKL
1000101010201030104010501060107010801090
EEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGH
1100111011201130114011501160117011801190
VTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
1200121012201230124012501260127012801290
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGH
13001310132013301340
QAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT
1
Features
DescriptionReceptor tyrosine-protein kinase erbB-3
Gene nameERBB3
Organism Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_001005915.1
NP_001973.2
none loaded A8K6L6
B4DIK7
B4DV32
E9PDT8
P21860
Q9BUD7
ERBB3_HUMAN
ENST00000267101
ENST00000411731
ENST00000415288
ENST00000450146
ENST00000551242
none loaded GO:0003197
GO:0004672
GO:0004888
GO:0005524
GO:0005615
GO:0005887
GO:0007162
GO:0007173
GO:0007507
GO:0008543
GO:0009968
GO:0014037
GO:0014065
GO:0014068
GO:0016323
GO:0016324
GO:0016328
GO:0019838
GO:0021545
GO:0030296
GO:0038095
GO:0042060
GO:0042127
GO:0042803
GO:0043235
GO:0043524
GO:0045087
GO:0046982
GO:0048011
GO:0051048
GO:0051402
GO:0097192
Kinase
Receptor
Transferase
Tyrosine-protein kinase
Display Chart Settings
 

Peak Areas

Retention Times