Protein / Label:sp|P02750|A2GL_HUMAN
Description:Leucine-rich alpha-2-glycoprotein OS=Homo sapiens GN=LRG1 PE=1 SV=2
Decoy:false
Note: 
File:CPTAC JHU Response Curves Batch 1 rev3_2014-12-09_17-20-16.sky.zip
0102030405060708090
MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLS
100110120130140150160170180190
SNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQL
1
200210220230240250260270280290
ETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
300310320330340
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
DescriptionLeucine-rich alpha-2-glycoprotein (short name: LRG)
Gene name(s)LRG1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_443204.1
none loaded Q96QZ4
Q8N4F5
P02750
A2GL_HUMAN
ENST00000306390
none loaded GO:0050873
GO:0016020
GO:0005615

Peak Areas

Retention Times