Protein / Label:sp|P02749|APOH_HUMAN
Description:Beta-2-glycoprotein 1 OS=Homo sapiens GN=APOH PE=1 SV=3
Decoy:false
Note: 
File:CPTAC JHU Response Curves Batch 1 rev3_2014-12-09_17-20-16.sky.zip
0102030405060708090
MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTF
100110120130140150160170180190
EYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPEC
1
200210220230240250260270280290
REVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFC
300310320330340
KNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
DescriptionBeta-2-glycoprotein 1
Gene name(s)APOH
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000033.2
none loaded Q9UCN7
P02749
B2R9M3
APOH_HUMAN
ENST00000205948
none loaded GO:0060230
GO:0051918
GO:0051006
GO:0042627
GO:0034392
GO:0034364
GO:0034361
GO:0034197
GO:0033033
GO:0031639
GO:0030195
GO:0016525
GO:0010596
GO:0009986
GO:0008201
GO:0007597
GO:0006641
GO:0005543
GO:0001937

Peak Areas

Retention Times