Protein / Label:RB1.IPI00302829
Description:IPI:IPI00302829.5|SWISS-PROT:P06400|TREMBL:B4DRB3;B4DTN0;P78495;Q59HH0;Q6DUF0;Q6LE65;Q6LE77;Q6LE79;Q6LE80;Q6LE81;Q6LE82;Q7KZ60;Q7KZ61;Q7Z5Q6;Q7Z7J0;Q86WG4|ENSEMBL:ENSP00000267163|REFSEQ:NP_000312|H-INV:HIT000193791|VEGA:OTTHUMP00000018397 Tax_Id=9606 Gene_Symbol=RB1 Retinoblastoma-associated protein
Decoy:false
Note: 
File:FileS1_IMAC_PO4_Curves_Pure_2015-08-27_10-10-22.sky.zip
0102030405060708090
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWG
100110120130140150160170180190
ICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLL
200210220230240250260270280290
AKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
1
300310320330340350360370380390
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENL
400410420430440450460470480490
ISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSR
500510520530540550560570580590
STSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
600610620630640650660670680690
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHL
700710720730740750760770780790
DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIP
<
800810820830840850860870880890
GGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
<< 1
900910920
LAEMTSTRTRMQKQKMNDSMDTSNKEEK
DescriptionRetinoblastoma-associated protein
Gene name(s)RB1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000312.2
NP_000312
none loaded P78495
B4DTN0
Q6LE79
Q7KZ61
Q86WG4
Q6DUF0
Q7Z5Q6
Q6LE82
B4DRB3
Q7KZ60
Q6LE77
Q6LE65
Q59HH0
Q6LE80
Q6LE81
Q7Z7J0
Q8IZL4
Q5VW46
P78499
P06400
A8K5E3
RB_HUMAN
ENSP00000267163
ENST00000267163
IPI00302829
GO:2000134
GO:0097284
GO:0090230
GO:0071930
GO:0071922
GO:0071459
GO:0051402
GO:0051146
GO:0050681
GO:0050680
GO:0048667
GO:0048565
GO:0045944
GO:0045893
GO:0045879
GO:0045842
GO:0045651
GO:0045445
GO:0043550
GO:0043433
GO:0043353
GO:0042551
GO:0035914
GO:0035189
GO:0034349
GO:0034088
GO:0031175
GO:0031134
GO:0030521
GO:0019900
GO:0016605
GO:0016514
GO:0016032
GO:0007265
GO:0007093
GO:0007070
GO:0007050
GO:0006469
GO:0006351
GO:0006338
GO:0005819
GO:0003713
GO:0003700
GO:0001047
GO:0000785
GO:0000083

Peak Areas

Retention Times