Protein / Label:LIG1.IPI00219841
Description:IPI:IPI00219841.6|SWISS-PROT:P18858|TREMBL:B4DM52;B4DTU4;B4DUE1;Q2TB12;Q59HG7;Q76GR4|ENSEMBL:ENSP00000263274|REFSEQ:NP_000225|H-INV:HIT000339046|VEGA:OTTHUMP00000077187 Tax_Id=9606 Gene_Symbol=LIG1 DNA ligase 1
Decoy:false
Note: 
File:FileS1_IMAC_PO4_Curves_Pure_2015-08-27_10-10-22.sky.zip
0102030405060708090
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPE
100110120130140150160170180190
NNASLSDTSPMDSSPSGIPKRRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQPTTPPKPLKTSKAETPTESV
1
200210220230240250260270280290
SEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
300310320330340350360370380390
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLT
400410420430440450460470480490
ASGVFSKFRDIARLTGSASTAKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAMVDAGKGKTAEARKTWLEEQG
500510520530540550560570580590
MILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
600610620630640650660670680690
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLD
700710720730740750760770780790
TKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGF
800810820830840850860870880890
SDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
900910
SQIQNQQGEDSGSDPEDTY
DescriptionDNA ligase 1
Gene name(s)LIG1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000225
NP_000225.1
none loaded Q59HG7
B4DTU4
B4DM52
B4DUE1
Q76GR4
Q2TB12
Q32P23
P18858
B2RAI8
DNLI1_HUMAN
ENSP00000263274
ENST00000263274
IPI00219841
GO:0051301
GO:0051103
GO:0046872
GO:0042542
GO:0032201
GO:0009653
GO:0006303
GO:0006297
GO:0006284
GO:0006283
GO:0006273
GO:0005739
GO:0005694
GO:0005654
GO:0005524
GO:0003910
GO:0003677
GO:0000724
GO:0000722
GO:0000278

Peak Areas

Retention Times