Protein / Label:IL16.IPI00289966
Description:IPI:IPI00289966.4|SWISS-PROT:Q14005-3|TREMBL:Q05BE6|ENSEMBL:ENSP00000353747;ENSP00000378147;ENSP00000378148|REFSEQ:NP_004504|VEGA:OTTHUMP00000176054;OTTHUMP00000190849 Tax_Id=9606 Gene_Symbol=IL16 Isoform 3 of Pro-interleukin-16
Decoy:false
Note: 
File:FileS1_IMAC_PO4_Curves_Pure_2015-08-27_10-10-22.sky.zip
0102030405060708090
MDYSFDTTAEDPWVRISDCIKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKVYKSADSSTVKKGPPVAPKPAWFRQSLKGLRN
100110120130140150160170180190
RASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIRQRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQPE
200210220230240250260270280290
QVLSSGSPAASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMPSQRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKS
1
300310320330340350360370380390
LLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDGDHSSLQSGQSVISLLSSEELKKLIEEVKVLD
400410420430440450460470480490
EATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTPE
500510520530540550560570580590
AMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAW
600610620630
NIIKALPDGPVTIVIRRKSLQSKETTAAGDS
DescriptionIPI:IPI00289966.4|SWISS-PROT:Q14005-3|TREMBL:Q05BE6|ENSEMBL:ENSP00000353747;ENSP00000378147;ENSP00000378148|REFSEQ:NP_004504|VEGA:OTTHUMP00000176054;OTTHUMP00000190849 Tax_Id=9606 Gene_Symbol=IL16...
Gene name(s)IL16
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_004504
none loaded Q05BE6
Q14005-3
none loaded ENSP00000353747
ENSP00000378147
ENSP00000378148
IPI00289966
none loaded

Peak Areas

Retention Times