Protein / Label:sp|O00762|UBE2C_HUMAN
Description:Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens GN=UBE2C PE=1 SV=1
Decoy:false
Note: 
File:DDRpanel_022817_curves_v8b_portal_2017-06-23_09-07-31.sky.zip
0102030405060708090
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLT
1 1
100110120130140150160170
PCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
DescriptionUbiquitin-conjugating enzyme E2 C
Gene name(s)UBE2C
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001268671.1
NP_861516.1
NP_008950.1
NP_001268670.1
NP_861517.1
NP_861515.1
none loaded O00762
G3XAB7
E1P5N7
A6NP33
UBE2C_HUMAN
ENST00000405520
ENST00000372568
ENST00000356455
ENST00000352551
ENST00000335046
none loaded GO:0070979
GO:0070936
GO:0051488
GO:0051437
GO:0051436
GO:0048015
GO:0031536
GO:0031145
GO:0010994
GO:0010458
GO:0008054
GO:0007094
GO:0007051
GO:0005829
GO:0005680
GO:0005654
GO:0005524
GO:0004842

Peak Areas

Retention Times