Protein / Label:sp|P12004|PCNA_HUMAN
Description:Proliferating cell nuclear antigen OS=Homo sapiens GN=PCNA PE=1 SV=1
Decoy:false
Note: 
File:DDRpanel_022817_curves_v8b_portal_2017-06-23_09-07-31.sky.zip
0102030405060708090
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLA
1 <
100110120130140150160170180190
LVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMN
<< 1 1
1
200210220230240250260
EPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
DescriptionProliferating cell nuclear antigen (short name: PCNA)
Gene name(s)PCNA
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_002583
NP_872590
NP_872590.1
NP_002583.1
none loaded Q7Z6A2
Q7Z6A1
Q7Z6A3
Q6FHF5
B4DUA2
Q6FI35
P12004
D3DW02
B2R897
PCNA_HUMAN
ENSP00000368458
ENSP00000368438
ENST00000379160
ENST00000379143
IPI00021700
GO:0070557
GO:0048015
GO:0046686
GO:0043626
GO:0043596
GO:0033993
GO:0032405
GO:0032201
GO:0032139
GO:0032077
GO:0030337
GO:0019985
GO:0015630
GO:0008283
GO:0007507
GO:0006298
GO:0006297
GO:0006284
GO:0006283
GO:0006275
GO:0006271
GO:0005737
GO:0005663
GO:0005654
GO:0000722
GO:0000701
GO:0000083

Peak Areas

Retention Times