Protein / Label:sp|O60934|NBN_HUMAN
Description:Nibrin OS=Homo sapiens GN=NBN PE=1 SV=1
Decoy:false
Note: 
File:DDRpanel_022817_curves_v8b_portal_2017-06-23_09-07-31.sky.zip
0102030405060708090
MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFG
100110120130140150160170180190
VFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPL
200210220230240250260270280290
DEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMDMLQRQ
300310320330340350360370380390
GLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMLSQDA
2
400410420430440450460470480490
PTVKESCKTSSNNNSMVSNTLAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLLEQTQPATPSL
2
500510520530540550560570580590
WKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETN
600610620630640650660670680690
DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLP
700710720730740750
HIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
DescriptionNibrin
Gene name(s)NBN
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005250980.1
NP_002476
NP_002476.2
none loaded A8K1D3
A0PJ71
A6H8Y5
Q7LDM2
Q63HR6
Q53FM6
Q32NF7
O60934
O60672
B2RNC5
B2R626
NBN_HUMAN
ENSP00000265433
ENST00000409330
ENST00000265433
IPI00299463
GO:0097193
GO:0050885
GO:0045190
GO:0042405
GO:0035861
GO:0033674
GO:0032508
GO:0031954
GO:0030870
GO:0030330
GO:0030174
GO:0016605
GO:0008283
GO:0007126
GO:0007095
GO:0007050
GO:0006200
GO:0005730
GO:0005657
GO:0003684
GO:0001832
GO:0000784
GO:0000724
GO:0000723

Peak Areas

Retention Times