Protein / Label:TPM2.IPI00218820
Description:IPI:IPI00218820.1|SWISS-PROT:P07951-3 Tax_Id=9606 Gene_Symbol=TPM2 Isoform 3 of Tropomyosin beta chain
Decoy:false
Note: 
File:GO_Hutch_Interlab_Curve_High_All_v4_2015-04-09_14-57-55.sky.zip
0102030405060708090
MAGISSIDAVKKKIQSLQQVADEAEERAEHLQREADAERQARERAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMK
100110120130140150160170180190
DEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMASEEEYSTKEDKYEEEIKLLEEKLKEAE
200210220230240
TRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLELNNL
1
DescriptionIPI:IPI00218820.1|SWISS-PROT:P07951-3 Tax_Id=9606 Gene_Symbol=TPM2 Isoform 3 of Tropomyosin beta chain
Gene name(s)TPM2
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P07951-3
none loaded none loaded IPI00218820
none loaded

Peak Areas

Retention Times