Protein / Label:NAGK.IPI00296526
Description:IPI:IPI00296526.6|TREMBL:B4DLZ5|ENSEMBL:ENSP00000389087 Tax_Id=9606 Gene_Symbol=NAGK N-acetylglucosamine kinase
Decoy:false
Note: 
File:GO_Hutch_Interlab_Curve_High_All_v4_2015-04-09_14-57-55.sky.zip
0102030405060708090
MRTRTGSQLAAREVTGSGAVPRQLEGRRCQAGRDANGGTSSDGSSSMAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVN
100110120130140150160170180190
RAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEG
1
200210220230240250260270280290
SAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEID
1
300310320330340350360370380
PVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
DescriptionIPI:IPI00296526.6|TREMBL:B4DLZ5|ENSEMBL:ENSP00000389087 Tax_Id=9606 Gene_Symbol=NAGK N-acetylglucosamine kinase
Gene name(s)NAGK
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded B4DLZ5
none loaded ENSP00000389087
IPI00296526
none loaded

Peak Areas

Retention Times