Protein / Label:HADHA.IPI00031522
Description:IPI:IPI00031522.2|SWISS-PROT:P40939|TREMBL:B4DDZ5;B4DRH6;Q53T69;Q53TA2;Q9UQC5|ENSEMBL:ENSP00000370023|REFSEQ:NP_000173|H-INV:HIT000034217|VEGA:OTTHUMP00000122457 Tax_Id=9606 Gene_Symbol=HADHA Trifunctional enzyme subunit alpha, mitochondrial
Decoy:false
Note: 
File:GO_Hutch_Interlab_Curve_High_All_v4_2015-04-09_14-57-55.sky.zip
0102030405060708090
MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSKVNTLSKELHSEFSEVMNEIWASDQIRSAVLISSKPGCFIA
100110120130140150160170180190
GADINMLAACKTLQEVTQLSQEAQRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRIATKDRKTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDM
1
200210220230240250260270280290
MLTGRSIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPA
300310320330340350360370380390
PLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRG
1
400410420430440450460470480490
QQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKRPEKVIGMHYF
500510520530540550560570580590
SPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVA
600610620630640650660670680690
EDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEG
700710720730740750760
DIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
DescriptionTrifunctional enzyme subunit alpha, mitochondrial
Gene name(s)HADHA
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000173.2
NP_000173
none loaded Q9UQC5
B4DDZ5
B4DRH6
Q96GT7
Q53TA2
Q53T69
Q16679
P40939
B2R7L4
ECHA_HUMAN
ENSP00000370023
ENST00000380649
IPI00031522
GO:0051287
GO:0046474
GO:0042645
GO:0042493
GO:0035965
GO:0032868
GO:0016509
GO:0016508
GO:0016507
GO:0006635
GO:0005743
GO:0005730
GO:0004300
GO:0003985
GO:0003857
GO:0000062

Peak Areas

Retention Times