Protein / Label:DDX1.IPI00293655
Description:IPI:IPI00293655.3|SWISS-PROT:Q92499|TREMBL:A3RJH1;B4DME8;B4DP70;B4DPN6|ENSEMBL:ENSP00000233084;ENSP00000370745|REFSEQ:NP_004930|H-INV:HIT000323104|VEGA:OTTHUMP00000115711 Tax_Id=9606 Gene_Symbol=DDX1 ATP-dependent RNA helicase DDX1
Decoy:false
Note: 
File:GO_Hutch_Interlab_Curve_High_All_v4_2015-04-09_14-57-55.sky.zip
0102030405060708090
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGS
<
100110120130140150160170180190
AFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDK
<< 1
200210220230240250260270280290
GHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE
300310320330340350360370380390
QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKR
400410420430440450460470480490
LQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRA
500510520530540550560570580590
IKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
600610620630640650660670680690
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGS
700710720730
YKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
1
DescriptionATP-dependent RNA helicase DDX1
Gene name(s)DDX1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_004930
NP_004930.1
none loaded B4DPN6
B4DME8
B4DP70
A3RJH1
Q92499
DDX1_HUMAN
ENSP00000233084
ENSP00000370745
ENST00000381341
ENST00000233084
IPI00293655
GO:0072669
GO:0071920
GO:0043330
GO:0033677
GO:0032508
GO:0010494
GO:0009615
GO:0008143
GO:0008026
GO:0007275
GO:0006446
GO:0006355
GO:0006351
GO:0006302
GO:0005524
GO:0004527
GO:0004518
GO:0003725
GO:0003724
GO:0003712
GO:0003682
GO:0003677
GO:0000245

Peak Areas

Retention Times