Protein / Label:C1QBP.IPI00014230
Description:IPI:IPI00014230.1|SWISS-PROT:Q07021|TREMBL:A8K651|ENSEMBL:ENSP00000225698|REFSEQ:NP_001203|H-INV:HIT000286556|VEGA:OTTHUMP00000183090 Tax_Id=9606 Gene_Symbol=C1QBP Complement component 1 Q subcomponent-binding protein, mitochondrial
Decoy:false
Note: 
File:GO_Hutch_Interlab_Curve_High_All_v4_2015-04-09_14-57-55.sky.zip
0102030405060708090
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHK
100110120130140150160170180190
TLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
200210220230240250260270280
SDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
1
DescriptionComplement component 1 Q subcomponent-binding protein, mitochondrial
Gene name(s)C1QBP
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001203
NP_001203.1
none loaded A8K651
Q9NNY8
Q2HXR8
Q07021
C1QBP_HUMAN
ENSP00000225698
ENST00000225698
IPI00014230
GO:2000510
GO:1901165
GO:1900026
GO:0097177
GO:0090023
GO:0070131
GO:0051897
GO:0050687
GO:0048025
GO:0045087
GO:0043065
GO:0042256
GO:0039536
GO:0039534
GO:0032695
GO:0032689
GO:0031690
GO:0030984
GO:0030449
GO:0016032
GO:0014065
GO:0009986
GO:0008380
GO:0008134
GO:0007597
GO:0006958
GO:0006955
GO:0006915
GO:0006397
GO:0006351
GO:0005886
GO:0005829
GO:0005759
GO:0005739
GO:0005730
GO:0005634
GO:0005615
GO:0005540
GO:0003729
GO:0003714
GO:0001849
GO:0000122

Peak Areas

Retention Times