Protein / Label:ADK.IPI00234368
Description:IPI:IPI00234368.1|SWISS-PROT:P55263-2|TREMBL:B7Z783;B7Z800;Q5JQ10;Q9HB33|ENSEMBL:ENSP00000361819|REFSEQ:NP_001114|VEGA:OTTHUMP00000019865 Tax_Id=9606 Gene_Symbol=ADK Isoform Short of Adenosine kinase
Decoy:false
Note: 
File:GO_Hutch_Interlab_Curve_High_All_v4_2015-04-09_14-57-55.sky.zip
0102030405060708090
MTSVRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILK
100110120130140150160170180190
RKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAP
1
200210220230240250260270280290
FISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGD
300310320330340
AFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH
DescriptionIPI:IPI00234368.1|SWISS-PROT:P55263-2|TREMBL:B7Z783;B7Z800;Q5JQ10;Q9HB33|ENSEMBL:ENSP00000361819|REFSEQ:NP_001114|VEGA:OTTHUMP00000019865 Tax_Id=9606 Gene_Symbol=ADK Isoform Short of Adenosine kinase
Gene name(s)ADK
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001114
none loaded Q9HB33
B7Z783
B7Z800
P55263-2
Q5JQ10
none loaded ENSP00000361819
IPI00234368
none loaded

Peak Areas

Retention Times