Protein / Label:ACTR3.IPI00028091
Description:IPI:IPI00028091.3|SWISS-PROT:P61158|TREMBL:B4DT29;B4DTI0;B4DXW1;Q53QM2;Q59FV6|ENSEMBL:ENSP00000263238|REFSEQ:NP_005712|H-INV:HIT000052876|VEGA:OTTHUMP00000203980 Tax_Id=9606 Gene_Symbol=ACTR3 Actin-related protein 3
Decoy:false
Note: 
File:GO_Hutch_Interlab_Curve_High_All_v4_2015-04-09_14-57-55.sky.zip
0102030405060708090
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKY
1
100110120130140150160170180190
LRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDI
1
200210220230240250260270280290
TYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
300310320330340350360370380390
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDY
400410
EEIGPSICRHNPVFGVMS
DescriptionActin-related protein 3
Gene name(s)ACTR3
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_005712.1
NP_005712
none loaded Q59FV6
B4DTI0
B4DT29
B4DXW1
Q53QM2
P61158
P32391
ARP3_HUMAN
ENSP00000263238
ENST00000263238
IPI00028091
GO:0060271
GO:0060076
GO:0051653
GO:0051491
GO:0050775
GO:0046677
GO:0045666
GO:0045087
GO:0043519
GO:0038096
GO:0033206
GO:0030838
GO:0030056
GO:0030027
GO:0010592
GO:0009743
GO:0008356
GO:0007163
GO:0006928
GO:0005885
GO:0005829
GO:0005524
GO:0002102
GO:0000139

Peak Areas

Retention Times