Protein / Label:SCARB2.IPI00217766
Description:IPI:IPI00217766.3|SWISS-PROT:Q14108|TREMBL:Q53Y63|ENSEMBL:ENSP00000264896|REFSEQ:NP_005497|H-INV:HIT000100456|VEGA:OTTHUMP00000160590 Tax_Id=9606 Gene_Symbol=SCARB2 Lysosome membrane protein 2
Decoy:false
Note: 
File:GO_Hutch_Hutch_Curve_High_All_v4_2015-04-09_14-48-28.sky.zip
0102030405060708090
MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANI
1
100110120130140150160170180190
QFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGYKDEILSLIHVFRPDISPYFG
200210220230240250260270280290
LFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAE
1
300310320330340350360370380390
ILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGD
400410420430440450460470
IRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPLIRT
DescriptionLysosome membrane protein 2
Gene name(s)SCARB2
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001191184.1
NP_005497
NP_005497.1
none loaded Q53Y63
Q14108
E7EM68
B4DKD8
SCRB2_HUMAN
ENSP00000264896
ENST00000452464
ENST00000264896
IPI00217766
GO:0043202
GO:0007155
GO:0006622
GO:0005887
GO:0005765
GO:0004872

Peak Areas

Retention Times