Protein / Label:PLOD3.IPI00030255
Description:IPI:IPI00030255.1|SWISS-PROT:O60568|TREMBL:B3KQQ3;Q9UG85|ENSEMBL:ENSP00000223127|REFSEQ:NP_001075|H-INV:HIT000035363|VEGA:OTTHUMP00000024963;OTTHUMP00000211487 Tax_Id=9606 Gene_Symbol=PLOD3 Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
Decoy:false
Note: 
File:GO_Hutch_Hutch_Curve_High_All_v4_2015-04-09_14-48-28.sky.zip
0102030405060708090
MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKY
100110120130140150160170180190
ADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYL
200210220230240250260270280290
DPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFL
300310320330340350360370380390
AVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEALSPGEARDMAMDLCRQDPECEFYFSLDADAVLTNL
1
400410420430440450460470480490
QTLRILIEENRKVIAPMLSRHGKLWSNFWGALSPDEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGDTLRMELPQRDVFSGSDTDPDMAFCKSFRDK
1
500510520530540550560570580590
GIFLHLSNQHEFGRLLATSRYDTEHLHPDLWQIFDNPVDWKEQYIHENYSRALEGEGIVEQPCPDVYWFPLLSEQMCDELVAEMEHYGQWSGGRHEDSRL
600610620630640650660670680690
AGGYENVPTVDIHMKQVGYEDQWLQLLRTYVGPMTESLFPGYHTKARAVMNFVVRYRPDEQPSLRPHHDSSTFTLNVALNHKGLDYEGGGCRFLRYDCVI
700710720730
SSPRKGWALLHPGRLTHYHEGLPTTWGTRYIMVSFVDP
DescriptionProcollagen-lysine,2-oxoglutarate 5-dioxygenase 3
Gene name(s)PLOD3
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001075.1
NP_001075
none loaded B3KQQ3
Q9UG85
Q540C3
O60568
B2R6W6
PLOD3_HUMAN
ENSP00000223127
ENST00000223127
IPI00030255
GO:0070831
GO:0060425
GO:0050211
GO:0048730
GO:0042311
GO:0033823
GO:0032870
GO:0031418
GO:0030867
GO:0030199
GO:0030198
GO:0021915
GO:0008475
GO:0008104
GO:0006464
GO:0005789
GO:0005506
GO:0001886
GO:0001701

Peak Areas

Retention Times