Protein / Label:NAP1L1.IPI00023860
Description:IPI:IPI00023860.1|SWISS-PROT:P55209|TREMBL:B7Z9C2|ENSEMBL:ENSP00000261182;ENSP00000376947|REFSEQ:NP_004528;NP_631946|H-INV:HIT000273970|VEGA:OTTHUMP00000168557;OTTHUMP00000168558 Tax_Id=9606 Gene_Symbol=NAP1L1 Nucleosome assembly protein 1-like 1
Decoy:false
Note: 
File:GO_Hutch_Hutch_Curve_High_All_v4_2015-04-09_14-48-28.sky.zip
0102030405060708090
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVH
1
100110120130140150160170180190
DLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIK
1
200210220230240250260270280290
VKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNF
300310320330340350360370380390
FAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
DescriptionNucleosome assembly protein 1-like 1
Gene name(s)NAP1L1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_004528
NP_631946.1
NP_004528.1
NP_631946
none loaded B7Z9C2
P55209
NP1L1_HUMAN
ENSP00000376947
ENSP00000261182
ENST00000393263
ENST00000261182
IPI00023860
GO:0042470
GO:0008284
GO:0006334
GO:0006260
GO:0005634

Peak Areas

Retention Times