Protein / Label:MSN.IPI00219365
Description:IPI:IPI00219365.3|SWISS-PROT:P26038|TREMBL:Q6PJT4|ENSEMBL:ENSP00000353408|REFSEQ:NP_002435|H-INV:HIT000037926|VEGA:OTTHUMP00000023438 Tax_Id=9606 Gene_Symbol=MSN Moesin
Decoy:false
Note: 
File:GO_Hutch_Hutch_Curve_High_All_v4_2015-04-09_14-48-28.sky.zip
0102030405060708090
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQR
100110120130140150160170180190
LFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEM
1
200210220230240250260270280290
YGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
300310320330340350360370380390
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAK
400410420430440450460470480490
EALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMA
500510520530540550560570
KDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
DescriptionMoesin
Gene name(s)MSN
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_002435
NP_002435.1
none loaded Q6PJT4
P26038
MOES_HUMAN
ENSP00000353408
ENST00000360270
IPI00219365
GO:2000401
GO:0070062
GO:0050900
GO:0045177
GO:0031528
GO:0030175
GO:0022614
GO:0019898
GO:0016324
GO:0016323
GO:0007159
GO:0005902
GO:0005886
GO:0005856
GO:0005737
GO:0005730
GO:0005200
GO:0003725
GO:0001931

Peak Areas

Retention Times