Protein / Label:LTA4H.IPI00219077
Description:IPI:IPI00219077.4|SWISS-PROT:P09960-1|TREMBL:B4DVZ8|ENSEMBL:ENSP00000228740|REFSEQ:NP_000886|H-INV:HIT000191156|VEGA:OTTHUMP00000168795 Tax_Id=9606 Gene_Symbol=LTA4H Isoform 1 of Leukotriene A-4 hydrolase
Decoy:false
Note: 
File:GO_Hutch_Hutch_Curve_High_All_v4_2015-04-09_14-48-28.sky.zip
0102030405060708090
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQE
100110120130140150160170180190
IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPC
200210220230240250260270280290
YLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
300310320330340350360370380390
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGG
400410420430440450460470480490
PEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDLSSHQL
1 <
500510520530540550560570580590
NEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
<< 1
600610
AMLVGKDLKVD
DescriptionLeukotriene A-4 hydrolase (short name: LTA-4 hydrolase)
Gene name(s)LTA4H
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000886
NP_001243572.1
NP_000886.1
NP_001243573.1
XP_005268928.1
none loaded B4DVZ8
P09960-1
Q9UCT7
Q6IAT6
P09960
F8VV40
B4DNQ9
LKHA4_HUMAN
ENSP00000228740
ENST00000552789
ENST00000413268
ENST00000228740
IPI00219077
GO:0043171
GO:0019370
GO:0019369
GO:0008270
GO:0008237
GO:0006954
GO:0006508
GO:0005829
GO:0005634
GO:0004463
GO:0004301
GO:0004177

Peak Areas

Retention Times