Protein / Label:ESD.IPI00411706
Description:IPI:IPI00411706.1|SWISS-PROT:P10768|ENSEMBL:ENSP00000367992|REFSEQ:NP_001975|H-INV:HIT000001899|VEGA:OTTHUMP00000018374 Tax_Id=9606 Gene_Symbol=ESD S-formylglutathione hydrolase
Decoy:false
Note: 
File:GO_Hutch_Hutch_Curve_High_All_v4_2015-04-09_14-48-28.sky.zip
0102030405060708090
MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFG
100110120130140150160170180190
TGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWK
1 1
200210220230240250260270280
AYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLNA
DescriptionS-formylglutathione hydrolase (short name: FGH)
Gene name(s)ESD
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005266335.1
NP_001975
NP_001975.1
none loaded Q9BVJ2
Q5TBV2
Q5TBV0
Q5TBU8
P10768
ESTD_HUMAN
ENSP00000367992
ENST00000378720
IPI00411706
GO:0052689
GO:0047374
GO:0046294
GO:0018738
GO:0016023
GO:0005794
GO:0005634

Peak Areas

Retention Times