Protein / Label:LARP1B.IPI00293654
Description:IPI:IPI00293654.6|ENSEMBL:ENSP00000403586|REFSEQ:NP_835144 Tax_Id=9606 Gene_Symbol=LARP1B La ribonucleoprotein domain family member 2 isoform 2
Decoy:false
Note: 
File:FileS1_IMAC_PO4_Curves_minCrude_pt2_2015-12-17_08-35-13.sky.zip
0102030405060708090
MENWPTPSELVNTGFQSVLSQGNKKPQNRKEKEEKVEKRSNSDSKENRETKLNGPGENVSEDEAQSSNQRKRANKHKWVPLHLDVVRSESQERPGSRNSS
100110120130140150160170180190
RCQPEANKPTHNNRRNDTRSWKRDREKRDDQDDVSSVRSEGGNIRGSFRGRGRGRGRGRGRGRGNPRLNFDYSYGYQEHGERTDQPFQTELNTSMMYYYD
200210220230240250260270280290
DGTGVQVYPVEEALLKEYIKRQIEYYFSVENLERDFFLRGKMDEQGFLPISLIAGFQRVQALTTNLNLILEALKDSTEVEIVDEKMRKKIEPEKWPIPGP
300310320330340350360370380390
PPRSVPPTDFSQLIDCPEFVPGQAFCSHTESAPNSPRIGSPLSPKKNSETSILQAMSRGLSTSLPDLDSEPWIEVKKRHQPAPVKLRESVSVPEGSLNQL
1
400410420430440450460470480490
CSSEEPEQEELDFLFDEEIEQIGRKNTFTDWSDNDSDYEIDDQDLNKILIVTQTPPYVKKHPGGDRTGTHMSRAKITSELAKVINDGLYYYEQDLWMEED
500510520
ENKHTAIKVIVSGQHLSTDALF
DescriptionIPI:IPI00293654.6|ENSEMBL:ENSP00000403586|REFSEQ:NP_835144 Tax_Id=9606 Gene_Symbol=LARP1B La ribonucleoprotein domain family member 2 isoform 2
Gene name(s)LARP1B
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_835144
none loaded none loaded none loaded ENSP00000403586
IPI00293654
none loaded

Peak Areas

Retention Times