Protein / Label:CAST.IPI00220857
Description:IPI:IPI00220857.3|SWISS-PROT:P20810-2|TREMBL:B7Z4U9;Q59HE3|ENSEMBL:ENSP00000343421;ENSP00000396558|REFSEQ:NP_001035910|VEGA:OTTHUMP00000179127 Tax_Id=9606 Gene_Symbol=CAST Isoform 2 of Calpastatin
Decoy:false
Note: 
File:FileS1_IMAC_PO4_Curves_minCrude_pt2_2015-12-17_08-35-13.sky.zip
0102030405060708090
MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPK
100110120130140150160170180190
TKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVT
200210220230240250260270280290
IPPKYRELLAKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIK
300310320330340350360370380390
EVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMC
2
400410420430440450460470480490
SIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLD
500510520530540550560570580590
ALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDT
600610620630640650660670680690
IPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
DescriptionIPI:IPI00220857.3|SWISS-PROT:P20810-2|TREMBL:B7Z4U9;Q59HE3|ENSEMBL:ENSP00000343421;ENSP00000396558|REFSEQ:NP_001035910|VEGA:OTTHUMP00000179127 Tax_Id=9606 Gene_Symbol=CAST Isoform 2 of Calpastatin
Gene name(s)CAST
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001035910
none loaded Q59HE3
P20810-2
B7Z4U9
none loaded ENSP00000343421
ENSP00000396558
IPI00220857
none loaded

Peak Areas

Retention Times