Protein / Label:PWP1.IPI00014298
Description:IPI:IPI00014298.3|SWISS-PROT:Q13610|TREMBL:B4DJV5;Q05BL3;Q53FW9;Q6PIN4;Q6PKI5;Q86X79;Q9BV37|ENSEMBL:ENSP00000258531|REFSEQ:NP_008993|H-INV:HIT000191856|VEGA:OTTHUMP00000169078 Tax_Id=9606 Gene_Symbol=PWP1 Periodic tryptophan protein 1 homolog
Decoy:false
Note: 
File:FileS1_IMAC_PO4_Curves_Crude_2015-08-27_10-18-03.sky.zip
0102030405060708090
MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEKLQEEGGGSDEEETGSPSEDGMQSARTQARPREPLEDGDPEDDRTLDDDELAEYDLDKY
100110120130140150160170180190
DEEGDPDAETLGESLLGLTVYGSNDQDPYVTLKDTEQYEREDFLIKPSDNLIVCGRAEQDQCNLEVHVYNQEEDSFYVHHDILLSAYPLSVEWLNFDPSP
200210220230240250260270280290
DDSTGNYIAVGNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKKGKKSSSAEGHTDAVLDLSWNKLIRNVLASASADNTVILWDMSLGKPAASLAVHTD
300310320330340350360370380390
KVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTWNHFSPCHFLASTDDGFVYNLDARSDKPIFTLNAHNDEISGLDLSSQIKGC
400410420430440450460470480490
LVTASADKYVKIWDILGDRPSLVHSRDMKMGVLFCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARNSSISGPFGSRSSDTPME
1
500
S
DescriptionPeriodic tryptophan protein 1 homolog
Gene name(s)PWP1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_008993
NP_008993.1
none loaded Q86X79
Q9BV37
B4DJV5
Q6PKI5
Q05BL3
Q6PIN4
Q53FW9
Q13610
A8K3R6
PWP1_HUMAN
ENSP00000258531
ENST00000412830
IPI00014298
GO:0006351
GO:0005634

Peak Areas

Retention Times