File FileS1_IMAC_PO4_Curves_Crude_2015-08-27_10-18-03.sky.zip
Description IPI:IPI00292009.9|SWISS-PROT:Q8WX93-2|TREMBL:B2RTX2;Q4W5A6|ENSEMBL:ENSP00000261509|REFSEQ:NP_057165|H-INV:HIT000080305 Tax_Id=9606 Gene_Symbol=PALLD Isoform 2 of Palladin
Decoy false
Note
Reproducibility Report
0102030405060708090
MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDSEKEISQIFSTSPASLCEHPSHKETKLGEHASRRPQDNRST
100110120130140150160170180190
PVQPLAEKQTKSISSPVSKRKPAMSPLLTRPSYIRSLRKAEKRGAKTPSTNVKPKTPHQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGESSSP
200210220230240250260270280290
DSGYLSPKNQPSALLSASASQSPMEDQGEMEREVKSPGARHCYQDNQDLAVPHNRKSHPQPHSALHFPAAPRFIQKLRSQEVAEGSRVYLECRVTGNPTP
300310320330340350360370380390
RVRWFCEGKELHNTPDIQIHCEGGDLHTLIIAEAFEDDTGRYTCLATNPSGSDTTSAEVFIEGASSTDSDSESLAFKSRAGAMPQAQKKTTSVSLTIGSS
400410420430440450460470480490
SPKTGVTTAVIQPLSVPVQQVHSPTSYLCRPDGTTTAYFPPVFTKELQNTAVAEGQVVVLECRVRGAPPLQVQWFRQGSEIQDSPDFRILQKKPRSTAEP
500510520530540550560570580590
EEICTLVIAETFPEDAGIFTCSARNDYGSATSTAQLVVTSANTENCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQ
600610620630640650660670680690
MQFNAAERETSGVHPSRGVNGLINGKANSNKSLPTPAVLLSPTKEPPPLLAKPKLGFPKKASRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQP
1
700710720730740750760770780790
RLTYEERMARRLLGADSATVFNIQEPEEETANQEYKVSSCEQRLISEIEYRLERSPVDESGDEVQYGDVPVENGMAPFFEMKLKHYKIFEGMPVTFTCRV
800810820830840850860870880890
AGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDE
900910920930940950960970980990
NEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELV
1000101010201030104010501060107010801090
VAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLD
1100
VYISRH
DescriptionIPI:IPI00292009.9|SWISS-PROT:Q8WX93-2|TREMBL:B2RTX2;Q4W5A6|ENSEMBL:ENSP00000261509|REFSEQ:NP_057165|H-INV:HIT000080305 Tax_Id=9606 Gene_Symbol=PALLD Isoform 2 of Palladin
Gene name(s)PALLD
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_057165
none loaded Q8WX93-2
B2RTX2
Q4W5A6
none loaded ENSP00000261509
IPI00292009
none loaded

Peak Areas

Retention Times