Protein / Label:NFATC1.IPI00032069
Description:IPI:IPI00032069.1|SWISS-PROT:O95644-1|TREMBL:B5B2M4|ENSEMBL:ENSP00000396667 Tax_Id=9606 Gene_Symbol=NFATC1 Isoform C-alpha of Nuclear factor of activated T-cells, cytoplasmic 1
Decoy:false
Note: 
File:FileS1_IMAC_PO4_Curves_Crude_2015-08-27_10-18-03.sky.zip
0102030405060708090
MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGY
100110120130140150160170180190
FLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASP
200210220230240250260270280290
QTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW
1
300310320330340350360370380390
LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPK
400410420430440450460470480490
PLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGK
500510520530540550560570580590
TVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
600610620630640650660670680690
QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPI
700710720730740750760770780790
IKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAV
800810820830840850860870880890
QDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEHSLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE
900910920930940
DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS
DescriptionNuclear factor of activated T-cells, cytoplasmic 1 (short name: NF-ATc1)
Gene name(s)NFATC1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001265602.1
NP_001265598.1
NP_765978.1
NP_765976.1
NP_001265601.1
NP_006153.2
NP_001265604.1
NP_765977.1
NP_765975.1
NP_001265599.1
none loaded O95644-1
Q2M1S3
Q15793
Q12865
O95644
B5B2N1
B5B2M9
B5B2M8
B5B2M7
B5B2M6
B5B2M5
B5B2M4
NFAC1_HUMAN
ENSP00000396667
ENST00000592223
ENST00000591814
ENST00000586434
ENST00000542384
ENST00000427363
ENST00000397790
ENST00000329101
ENST00000318065
ENST00000253506
IPI00032069
GO:0048273
GO:0045087
GO:0038095
GO:0035556
GO:0030316
GO:0007507
GO:0006816
GO:0005829
GO:0005667
GO:0005654
GO:0005528
GO:0001837
GO:0001205
GO:0001085
GO:0000980
GO:0000790
GO:0000082

Peak Areas

Retention Times