Protein / Label:PSMD5.IPI00002134
Description:IPI:IPI00002134.4|SWISS-PROT:Q16401|TREMBL:A8K4T6|ENSEMBL:ENSP00000210313|REFSEQ:NP_005038|H-INV:HIT000036727|VEGA:OTTHUMP00000021990 Tax_Id=9606 Gene_Symbol=PSMD5 26S proteasome non-ATPase regulatory subunit 5
Decoy:false
Note: 
File:GO_Broad_Targets_HighCurve_Final_050612_v2_2015-04-09_15-13-58.sky.zip
0102030405060708090
MAAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAMEPVHVARNLRVDLQRGLIHPDDSVK
100110120130140150160170180190
ILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLSVAKAAIKSLSRISLTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESL
200210220230240250260270280290
NYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKV
300310320330340350360370380390
FEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFR
400410420430440450460470480490
GISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAV
1 1
500
EGAE
Description26S proteasome non-ATPase regulatory subunit 5
Gene name(s)PSMD5
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_005038
NP_001257356.1
NP_005038.1
none loaded A8K4T6
Q4VXG8
Q16401
Q15045
B4DZM8
PSMD5_HUMAN
ENSP00000210313
ENST00000373904
ENST00000210313
IPI00002134
GO:0070682
GO:0051437
GO:0051436
GO:0044281
GO:0043066
GO:0031145
GO:0022624
GO:0016071
GO:0016032
GO:0010467
GO:0006977
GO:0006915
GO:0006521
GO:0006457
GO:0005829
GO:0005654
GO:0002479
GO:0000209
GO:0000082

Peak Areas

Retention Times