Protein / Label:H2AFY.IPI00059366
Description:IPI:IPI00059366.4|SWISS-PROT:O75367-3|ENSEMBL:ENSP00000302572;ENSP00000378410|REFSEQ:NP_001035248;NP_004884|H-INV:HIT000001743|VEGA:OTTHUMP00000159414 Tax_Id=9606 Gene_Symbol=H2AFY Isoform 3 of Core histone macro-H2A.1
Decoy:false
Note: 
File:GO_Broad_Targets_HighCurve_Final_050612_v2_2015-04-09_15-13-58.sky.zip
0102030405060708090
MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTI
100110120130140150160170180190
ASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIH
1
200210220230240250260270280290
SEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALA
300310320330340350360370
DDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN
1
DescriptionIPI:IPI00059366.4|SWISS-PROT:O75367-3|ENSEMBL:ENSP00000302572;ENSP00000378410|REFSEQ:NP_001035248;NP_004884|H-INV:HIT000001743|VEGA:OTTHUMP00000159414 Tax_Id=9606 Gene_Symbol=H2AFY Isoform 3 of Co...
Gene name(s)H2AFY
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_004884
NP_001035248
none loaded O75367-3
none loaded ENSP00000378410
ENSP00000302572
IPI00059366
none loaded

Peak Areas

Retention Times