Protein / Label:ETFA.IPI00010810
Description:IPI:IPI00010810.1|SWISS-PROT:P13804|TREMBL:Q53XN3|ENSEMBL:ENSP00000267950|REFSEQ:NP_000117|H-INV:HIT000273184|VEGA:OTTHUMP00000176507 Tax_Id=9606 Gene_Symbol=ETFA Electron transfer flavoprotein subunit alpha, mitochondrial
Decoy:false
Note: 
File:GO_Broad_Targets_HighCurve_Final_050612_v2_2015-04-09_15-13-58.sky.zip
0102030405060708090
MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQ
100110120130140150160170180190
KQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSGGSASSEKASSTSPVEISEWL
1
200210220230240250260270280290
DQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAIN
1
300310320330
KDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
DescriptionElectron transfer flavoprotein subunit alpha, mitochondrial (short name: Alpha-ETF)
Gene name(s)ETFA
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000117
NP_001121188.1
NP_000117.1
none loaded Q53XN3
P13804
B4DT43
ETFA_HUMAN
ENSP00000267950
ENST00000557943
ENST00000433983
IPI00010810
GO:0050660
GO:0044281
GO:0022904
GO:0016491
GO:0009055
GO:0005759

Peak Areas

Retention Times