Protein / Label:DDX17.IPI00651653
Description:IPI:IPI00651653.1|SWISS-PROT:Q92841-3|ENSEMBL:ENSP00000403007|H-INV:HIT000267366|VEGA:OTTHUMP00000199223 Tax_Id=9606 Gene_Symbol=DDX17 Isoform 3 of Probable ATP-dependent RNA helicase DDX17
Decoy:false
Note: 
File:GO_Broad_Targets_HighCurve_Final_050612_v2_2015-04-09_15-13-58.sky.zip
0102030405060708090
MRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFP
100110120130140150160170180190
QYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIY
1
200210220230240250260270280290
GGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINV
300310320330340350360370380390
GNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVAS
1
400410420430440450460470480490
RGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGKGGRSRYRTTSSANNPN
500510520530540550560570580590
LMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQ
600610620630640650
QFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK
DescriptionIPI:IPI00651653.1|SWISS-PROT:Q92841-3|ENSEMBL:ENSP00000403007|H-INV:HIT000267366|VEGA:OTTHUMP00000199223 Tax_Id=9606 Gene_Symbol=DDX17 Isoform 3 of Probable ATP-dependent RNA helicase DDX17
Gene name(s)DDX17
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded Q92841-3
none loaded ENSP00000403007
IPI00651653
none loaded

Peak Areas

Retention Times