Protein / Label:DBN1.IPI00003406
Description:IPI:IPI00003406.4|SWISS-PROT:Q16643-1|TREMBL:B3KSQ7;B7Z2Z0|ENSEMBL:ENSP00000308532|REFSEQ:NP_004386|H-INV:HIT000101074|VEGA:OTTHUMP00000161448 Tax_Id=9606 Gene_Symbol=DBN1 Isoform 1 of Drebrin
Decoy:false
Note: 
File:GO_Broad_Targets_HighCurve_Final_050612_v2_2015-04-09_15-13-58.sky.zip
0102030405060708090
MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACAS
100110120130140150160170180190
HVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKAL
200210220230240250260270280290
DERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERV
1
300310320330340350360370380390
ASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGP
1
400410420430440450460470480490
MEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPS
500510520530540550560570580590
GTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQ
600610620630640
SQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFEGGD
DescriptionDrebrin
Gene name(s)DBN1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005265884.1
NP_543157.1
NP_004386.2
NP_004386
none loaded B3KSQ7
B7Z2Z0
Q16643-1
Q9UFZ5
Q16643
B2RBG0
A8MV58
DREB_HUMAN
ENSP00000308532
ENST00000393565
ENST00000309007
ENST00000292385
IPI00003406
GO:0061351
GO:0050773
GO:0048168
GO:0042641
GO:0032507
GO:0030425
GO:0010644
GO:0010643
GO:0007015
GO:0005938
GO:0005921
GO:0005886
GO:0005737
GO:0005522
GO:0003779

Peak Areas

Retention Times