Protein / Label:CRAT.IPI00016457
Description:IPI:IPI00016457.5|SWISS-PROT:P43155-1|ENSEMBL:ENSP00000315013|REFSEQ:NP_000746|VEGA:OTTHUMP00000161683 Tax_Id=9606 Gene_Symbol=CRAT Isoform 1 of Carnitine O-acetyltransferase
Decoy:false
Note: 
File:GO_Broad_Targets_HighCurve_Final_050612_v2_2015-04-09_15-13-58.sky.zip
0102030405060708090
MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSE
1
100110120130140150160170180190
WWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPP
1
200210220230240250260270280290
THITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVY
300310320330340350360370380390
RSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPLVPLPMPKKLRFNITPEIKSDIEKAKQNL
400410420430440450460470480490
SIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAV
500510520530540550560570580590
QAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNA
600610620
ARLAHYLEKALLDMRALLQSHPRAKL
DescriptionCarnitine O-acetyltransferase (short name: Carnitine acetylase)
Gene name(s)CRAT
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000746
XP_005251765.1
NP_001244292.1
NP_000746.2
XP_005251766.1
none loaded P43155-1
Q9BW16
Q5T952
P43155
CACP_HUMAN
ENSP00000315013
ENST00000318080
IPI00016457
GO:0033540
GO:0019254
GO:0006810
GO:0005783
GO:0005782
GO:0005743
GO:0005739
GO:0004092

Peak Areas

Retention Times