Protein / Label:CKAP4.IPI00141318
Description:IPI:IPI00141318.2|SWISS-PROT:Q07065-1|ENSEMBL:ENSP00000367265|REFSEQ:NP_006816|H-INV:HIT000323075|VEGA:OTTHUMP00000169048 Tax_Id=9606 Gene_Symbol=CKAP4 Isoform 1 of Cytoskeleton-associated protein 4
Decoy:false
Note: 
File:GO_Broad_Targets_HighCurve_Final_050612_v2_2015-04-09_15-13-58.sky.zip
0102030405060708090
MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGHRGGGGGGGKSSSSSSASAAAAAAAASSSASC
100110120130140150160170180190
SRRLGRALNFLFYLALVAAAAFSGWCVHHVLEEVQQVRRSHQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQHKQDLTEKAVKQGESEVSRI
200210220230240250260270280290
SEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSA
300310320330340350360370380390
KSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFE
400410420430440450460470480490
ALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTV
1
500510520530540550560570580590
ESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHE
1
600
KV
DescriptionCytoskeleton-associated protein 4
Gene name(s)CKAP4
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_006816
NP_006816.2
none loaded Q07065-1
Q53ES6
Q504S5
Q07065
CKAP4_HUMAN
ENSP00000367265
ENST00000378026
IPI00141318
GO:0048471
GO:0016021
GO:0005886
GO:0005856
GO:0005811
GO:0005789

Peak Areas

Retention Times