Protein / Label:CDKN2A.IPI00001560
Description:IPI:IPI00001560.2|SWISS-PROT:P42771-2|TREMBL:A5X2G7;A7LNE7|ENSEMBL:ENSP00000394932;ENSP00000418915|H-INV:HIT000218823 Tax_Id=9606 Gene_Symbol=CDKN2A Cyclin-dependent kinase inhibitor
Decoy:false
Note: 
File:GO_Broad_Targets_HighCurve_Final_050612_v2_2015-04-09_15-13-58.sky.zip
0102030405060708090
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA
1
100110120130140150160
GARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSEMIGNHLWVCRSRHA
1
DescriptionIPI:IPI00001560.2|SWISS-PROT:P42771-2|TREMBL:A5X2G7;A7LNE7|ENSEMBL:ENSP00000394932;ENSP00000418915|H-INV:HIT000218823 Tax_Id=9606 Gene_Symbol=CDKN2A Cyclin-dependent kinase inhibitor
Gene name(s)CDKN2A
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded A7LNE7
P42771-2
A5X2G7
none loaded ENSP00000394932
ENSP00000418915
IPI00001560
none loaded

Peak Areas

Retention Times