Protein / Label:sp|P32119|PRDX2_HUMAN
Description:Peroxiredoxin-2 OS=Homo sapiens GN=PRDX2 PE=1 SV=5
Decoy:false
Note: 
File:Broad_DepletedPlasma_TSQQuantiva_DirectMRM_Exp1_160630_2016-08-31_17-57-19.sky.zip
0102030405060708090
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN
1
100110120130140150160170180190
IPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
1 1
DescriptionPeroxiredoxin-2
Gene name(s)PRDX2
Organisms Macaca fascicularis

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P32119
Q2PFZ3
PRDX2_HUMAN
PRDX2_MACFA
none loaded none loaded GO:0051920
GO:0005737
GO:0004601

Peak Areas

Retention Times