Protein / Label:sp|Q14116|IL18_HUMAN
Description:Interleukin-18 OS=Homo sapiens GN=IL18 PE=1 SV=1
Decoy:false
Note: 
File:Broad_DepletedPlasma_TSQQuantiva_DirectMRM_Exp1_160630_2016-08-31_17-57-19.sky.zip
0102030405060708090
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTI
1 1 >>
100110120130140150160170180190
SVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED
> 1 1 1
DescriptionInterleukin-18 (short name: IL-18)
Gene name(s)IL18
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001553.1
NP_001230140.1
none loaded Q6WWJ7
Q6FGY3
Q14116
O75599
IL18_HUMAN
ENST00000528832
ENST00000524595
ENST00000280357
none loaded GO:0071407
GO:0051142
GO:0050729
GO:0042346
GO:0042253
GO:0042231
GO:0042104
GO:0042095
GO:0042094
GO:0042092
GO:0042088
GO:0042033
GO:0034105
GO:0032819
GO:0032740
GO:0032729
GO:0032725
GO:0031663
GO:0030431
GO:0030155
GO:0030101
GO:0010628
GO:0007267
GO:0006954
GO:0005829
GO:0005615
GO:0005576
GO:0005125
GO:0001525
GO:0000165

Peak Areas

Retention Times