Protein / Label:sp|P04792|HSPB1_HUMAN
Description:Heat shock protein beta-1 OS=Homo sapiens GN=HSPB1 PE=1 SV=2
Decoy:false
Note: 
File:Broad_DepletedPlasma_TSQQuantiva_DirectMRM_Exp1_160630_2016-08-31_17-57-19.sky.zip
0102030405060708090
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLD
1 1 <
100110120130140150160170180190
VNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSD
<< 1 1 1
200
ETAAK
DescriptionHeat shock protein beta-1 (short name: HspB1)
Gene name(s)HSPB1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001531.1
NP_001531
none loaded Q9UC36
Q9UC35
Q9UC34
Q9UC31
Q96EI7
Q96C20
Q6FI47
P04792
B2R4N8
HSPB1_HUMAN
ENSP00000248553
ENST00000248553
IPI00025512
GO:1902176
GO:0045766
GO:0043536
GO:0043130
GO:0043122
GO:0043066
GO:0042535
GO:0038033
GO:0035556
GO:0032731
GO:0030018
GO:0016071
GO:0010467
GO:0009615
GO:0008426
GO:0008219
GO:0006986
GO:0006928
GO:0006446
GO:0005886
GO:0005856
GO:0005829
GO:0005819
GO:0005634
GO:0005080
GO:0000502

Peak Areas

Retention Times