Protein / Label:sp|Q9Y385|UB2J1_HUMAN
Description:Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens GN=UBE2J1 PE=1 SV=2
Decoy:false
Note: 
File:Broad_IMACMRM2_Exp1_160830_2016-08-31_17-23-23.sky.zip
0102030405060708090
METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPE
100110120130140150160170180190
TWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESD
1
200210220230240250260270280290
LNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAA
300310
LIFRRIYLANEYIFDFEL
DescriptionUbiquitin-conjugating enzyme E2 J1
Gene name(s)UBE2J1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_057105.2
none loaded Q9Y385
Q9UF10
Q9P0S0
Q9P011
Q9NY66
Q9NQL3
Q9BZ32
Q5W0N4
Q53F25
A8K3F9
UB2J1_HUMAN
ENST00000435041
none loaded GO:0030433
GO:0018279
GO:0016021
GO:0005789
GO:0005524
GO:0004842

Peak Areas

Retention Times