Protein / Label:sp|P16949|STMN1_HUMAN
Description:Stathmin OS=Homo sapiens GN=STMN1 PE=1 SV=3
Decoy:false
Note: 
File:Broad_IMACMRM2_Exp1_160830_2016-08-31_17-23-23.sky.zip
0102030405060708090
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEK
1
100110120130140
LTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
DescriptionStathmin
Gene name(s)STMN1
Organisms Sus scrofa

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005665169.1
XP_005665171.1
NP_001009582.1
XP_005665170.1
none loaded P16949
Q6DUB7
STMN1_HUMAN
STMN1_PIG
ENSSSCT00000025212
none loaded GO:0051272
GO:0031115
GO:0016020
GO:0009615
GO:0007409
GO:0007052
GO:0007019
GO:0005874
GO:0005829

Peak Areas

Retention Times