Protein / Label:sp|P29353|SHC1_HUMAN
Description:SHC-transforming protein 1 OS=Homo sapiens GN=SHC1 PE=1 SV=4
Decoy:false
Note: 
File:Broad_IMACMRM2_Exp1_160830_2016-08-31_17-23-23.sky.zip
0102030405060708090
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMP
100110120130140150160170180190
DSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVP
200210220230240250260270280290
GAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
300310320330340350360370380390
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPV
400410420430440450460470480490
GGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLSRREAEA
1
500510520530540550560570580
LLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
DescriptionSHC-transforming protein 1
Gene name(s)SHC1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_892113.4
NP_001189788.1
NP_001123512.1
NP_001123513.1
NP_003020.2
none loaded Q96CL1
Q8N4K5
Q5T186
Q5T185
Q5T184
Q5T183
Q5T180
P29353
O15290
D3DV78
B5BU19
SHC1_HUMAN
ENST00000448116
ENST00000368453
ENST00000368450
ENST00000368445
none loaded GO:0070435
GO:0050900
GO:0048011
GO:0045740
GO:0045087
GO:0040008
GO:0038095
GO:0031532
GO:0030168
GO:0016337
GO:0008543
GO:0008286
GO:0008284
GO:0007507
GO:0007265
GO:0007176
GO:0007173
GO:0006987
GO:0005829
GO:0005759
GO:0005543
GO:0005154
GO:0005068
GO:0004713
GO:0001525
GO:0000187
GO:0000165

Peak Areas

Retention Times