Protein / Label:sp|P27361|MK03_HUMAN
Description:Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4
Decoy:false
Note: 
File:Broad_IMACMRM2_Exp1_160830_2016-08-31_17-23-23.sky.zip
0102030405060708090
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENV
100110120130140150160170180190
IGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGF
3 >>
200210220230240250260270280290
LTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
>
300310320330340350360370
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP

Peak Areas

Retention Times