Protein / Label:sp|Q16539|MK14_HUMAN
Description:Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3
Decoy:false
Note: 
File:Broad_IMACMRM2_Exp1_160830_2016-08-31_17-23-23.sky.zip
0102030405060708090
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFN
100110120130140150160170180190
DVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHY
2
200210220230240250260270280290
NQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
300310320330340350
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Peak Areas

Retention Times