Protein / Label:sp|P10398|ARAF_HUMAN
Description:Serine/threonine-protein kinase A-Raf OS=Homo sapiens GN=ARAF PE=1 SV=2
Decoy:false
Note: 
File:Broad_IMACMRM_Exp1.3_160829_2016-08-31_17-16-38.sky.zip
0102030405060708090
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHN
100110120130140150160170180190
FVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFP
200210220230240250260270280290
APANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSG
<
300310320330340350360370380390
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTR
<< 1
400410420430440450460470480490
FDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLY
500510520530540550560570580590
ELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
600
AARLVP
DescriptionSerine/threonine-protein kinase A-Raf
Gene name(s)ARAF
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001645.1
NP_001243125.1
NP_001243126.1
none loaded Q5H9B3
Q5H9B2
P10398
P07557
ARAF_HUMAN
ENST00000377045
ENST00000377039
none loaded GO:0046872
GO:0043066
GO:0033138
GO:0032434
GO:0032006
GO:0005739
GO:0005524
GO:0005057
GO:0004674

Peak Areas

Retention Times