Protein / Label:sp|Q9UMX1|SUFU_HUMAN
Description:Suppressor of fused homolog OS=Homo sapiens GN=SUFU PE=1 SV=2
Decoy:false
Note: 
File:Broad_IMACMRM_Exp1.1_160829_2016-08-31_17-13-48.sky.zip
0102030405060708090
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPEHWHYISFGLSDLYG
100110120130140150160170180190
DNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDPQMQPVQTPFGVVTFLQI
200210220230240250260270280290
VGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRL
300310320330340350360370380390
SGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSI
1
400410420430440450460470480
TGDMAITFVSTGVEGAFATEEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSPLH
DescriptionSuppressor of fused homolog (short name: SUFUH)
Gene name(s)SUFU
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_057253.2
NP_001171604.1
none loaded Q9UMY0
Q9UMX1
Q9UHM8
Q9UHK2
Q9NZ07
Q9NT90
Q7LCP7
SUFU_HUMAN
ENST00000423559
ENST00000369902
ENST00000369899
none loaded GO:2000059
GO:1901621
GO:0072372
GO:0045879
GO:0045668
GO:0043588
GO:0043433
GO:0042994
GO:0042992
GO:0021776
GO:0021775
GO:0008134
GO:0006508
GO:0005737
GO:0005634
GO:0004871
GO:0003714
GO:0001947
GO:0001843
GO:0001501
GO:0000122

Peak Areas

Retention Times