Protein / Label:sp|P53350|PLK1_HUMAN
Description:Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1
Decoy:false
Note: 
File:Broad_IMACMRM_Exp1.1_160829_2016-08-31_17-13-48.sky.zip
0102030405060708090
MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSM
100110120130140150160170180190
EISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATK
1
200210220230240250260270280290
VEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
1
300310320330340350360370380390
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEA
400410420430440450460470480490
EDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPR
500510520530540550560570580590
EGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
600
KAS
DescriptionSerine/threonine-protein kinase PLK1
Gene name(s)PLK1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_005021.2
none loaded Q99746
Q15153
P53350
PLK1_HUMAN
ENST00000300093
none loaded GO:0071168
GO:0051297
GO:0051233
GO:0046677
GO:0045736
GO:0043393
GO:0043066
GO:0040038
GO:0031648
GO:0031572
GO:0031145
GO:0030496
GO:0018105
GO:0016567
GO:0010800
GO:0008283
GO:0008017
GO:0007094
GO:0007092
GO:0007091
GO:0007077
GO:0005876
GO:0005829
GO:0005813
GO:0005654
GO:0005524
GO:0004674
GO:0001578
GO:0000942
GO:0000922
GO:0000281
GO:0000122
GO:0000086
GO:0000070

Peak Areas

Retention Times