Protein Note/Annotations
 
NISTmAb_HC  
Peptide Note/Annotations
Precursor Note/Annotations
QVTLR0615.3704 QVTLRlight1+616.3777615.370430.0000 
QVTLR0615.3704 QVTLRlight2+308.6925615.370430.0000 
QVTLR0598.3439 QVTLRlight1+599.3511598.343930.0000 
QVTLR0598.3439 QVTLRlight2+300.1792598.343930.0000 
ESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIR03699.8641 ESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRlight3+1234.29533699.864130.0000 
ESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIR03699.8641 ESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRlight4+925.97333699.864130.0000 
QPPGK0525.2911 QPPGKlight1+526.2984525.291130.0000 
ALEWLADIWWDDK01659.7933 ALEWLADIWWDDKlight1+1660.80061659.793330.0000 
ALEWLADIWWDDK01659.7933 ALEWLADIWWDDKlight2+830.90391659.793330.0000 
ALEWLADIWWDDK01659.7933 ALEWLADIWWDDKlight3+554.27171659.793330.0000 
ALEWLADIWWDDK01659.7933 ALEWLADIWWDDKlight4+415.95561659.793330.0000 
HYNPSLK0857.4396 HYNPSLKlight1+858.4468857.439630.0000 
HYNPSLK0857.4396 HYNPSLKlight2+429.7271857.439630.0000 
LTISK0560.3534 LTISKlight1+561.3606560.353430.0000 
NQVVLK0699.4279 NQVVLKlight1+700.4352699.427930.0000 
NQVVLK0699.4279 NQVVLKlight2+350.7212699.427930.0000 
VTNMDPADTATYYCAR01847.7818 VTNMDPADTATYYCARlight2+924.89821847.781830.0000 
VTNMDPADTATYYCAR01847.7818 VTNMDPADTATYYCARlight3+616.93461847.781830.0000 
VTNMDPADTATYYCAR01847.7818 VTNMDPADTATYYCARlight4+462.95271847.781830.0000 
VTNMDPADTATYYCAR01863.7767 VTNMDPADTATYYCARlight2+932.89571863.776730.0000 
VTNMDPADTATYYCAR01863.7767 VTNMDPADTATYYCARlight3+622.26621863.776730.0000 
VTNMDPADTATYYCAR01863.7767 VTNMDPADTATYYCARlight4+466.95151863.776730.0000 
DMIFNFYFDVWGQGTTVTVSSASTK02800.3054 DMIFNFYFDVWGQGTTVTVSSASTKlight2+1401.16002800.305430.0000 
DMIFNFYFDVWGQGTTVTVSSASTK02800.3054 DMIFNFYFDVWGQGTTVTVSSASTKlight3+934.44242800.305430.0000 
DMIFNFYFDVWGQGTTVTVSSASTK02800.3054 DMIFNFYFDVWGQGTTVTVSSASTKlight4+701.08362800.305430.0000 
GPSVFPLAPSSK01185.6394 GPSVFPLAPSSKlight1+1186.64661185.639430.0000 
GPSVFPLAPSSK01185.6394 GPSVFPLAPSSKlight2+593.82701185.639430.0000 
GPSVFPLAPSSK01185.6394 GPSVFPLAPSSKlight3+396.22041185.639430.0000 
STSGGTAALGCLVK01320.6708 STSGGTAALGCLVKlight1+1321.67801320.670830.0000 
STSGGTAALGCLVK01320.6708 STSGGTAALGCLVKlight2+661.34271320.670830.0000 
STSGGTAALGCLVK01320.6708 STSGGTAALGCLVKlight3+441.23091320.670830.0000 
STSGGTAALGCLVK01320.6708 STSGGTAALGCLVKlight4+331.17501320.670830.0000 
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK06712.3072 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKlight4+1679.08416712.307230.0000 
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK06712.3072 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKlight5+1343.46876712.307230.0000 
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK06712.3072 DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKlight6+1119.72516712.307230.0000 
THTCPPCPAPELLGGPSVFLFPPKPK02843.4503 THTCPPCPAPELLGGPSVFLFPPKPKlight2+1422.73242843.450330.0000 
THTCPPCPAPELLGGPSVFLFPPKPK02843.4503 THTCPPCPAPELLGGPSVFLFPPKPKlight3+948.82402843.450330.0000 
THTCPPCPAPELLGGPSVFLFPPKPK02843.4503 THTCPPCPAPELLGGPSVFLFPPKPKlight4+711.86982843.450330.0000 
DTLMISR0834.4269 DTLMISRlight1+835.4342834.426930.0000 
DTLMISR0834.4269 DTLMISRlight2+418.2207834.426930.0000 
DTLMISR0850.4219 DTLMISRlight1+851.4291850.421930.0000 
DTLMISR0850.4219 DTLMISRlight2+426.2182850.421930.0000 
TPEVTCVVVDVSHEDPEVK02138.0202 TPEVTCVVVDVSHEDPEVKlight2+1070.01742138.020230.0000 
TPEVTCVVVDVSHEDPEVK02138.0202 TPEVTCVVVDVSHEDPEVKlight3+713.68072138.020230.0000 
TPEVTCVVVDVSHEDPEVK02138.0202 TPEVTCVVVDVSHEDPEVKlight4+535.51232138.020230.0000 
FNWYVDGVEVHNAK01676.7947 FNWYVDGVEVHNAKlight1+1677.80201676.794730.0000 
FNWYVDGVEVHNAK01676.7947 FNWYVDGVEVHNAKlight2+839.40461676.794730.0000 
FNWYVDGVEVHNAK01676.7947 FNWYVDGVEVHNAKlight3+559.93881676.794730.0000 
FNWYVDGVEVHNAK01676.7947 FNWYVDGVEVHNAKlight4+420.20601676.794730.0000 
EEQYNSTYR01188.5047 EEQYNSTYRlight1+1189.51201188.504730.0000 
EEQYNSTYR01188.5047 EEQYNSTYRlight2+595.25961188.504730.0000 
EEQYNSTYR01188.5047 EEQYNSTYRlight3+397.17551188.504730.0000 
EEQYNSTYR02957.1442 EEQYNSTYRlight2+1479.57942957.144230.0000 
EEQYNSTYR02957.1442 EEQYNSTYRlight3+986.72202957.144230.0000 
EEQYNSTYR02957.1442 EEQYNSTYRlight4+740.29332957.144230.0000 
EEQYNSTYR02795.0914 EEQYNSTYRlight2+1398.55302795.091430.0000 
EEQYNSTYR02795.0914 EEQYNSTYRlight3+932.70442795.091430.0000 
EEQYNSTYR02795.0914 EEQYNSTYRlight4+699.78012795.091430.0000 
EEQYNSTYR02633.0386 EEQYNSTYRlight2+1317.52662633.038630.0000 
EEQYNSTYR02633.0386 EEQYNSTYRlight3+878.68682633.038630.0000 
EEQYNSTYR02633.0386 EEQYNSTYRlight4+659.26692633.038630.0000 
VVSVLTVLHQDWLNGK01806.9992 VVSVLTVLHQDWLNGKlight2+904.50691806.999230.0000 
VVSVLTVLHQDWLNGK01806.9992 VVSVLTVLHQDWLNGKlight3+603.34031806.999230.0000 
VVSVLTVLHQDWLNGK01806.9992 VVSVLTVLHQDWLNGKlight4+452.75711806.999230.0000 
ALPAPIEK0837.4960 ALPAPIEKlight1+838.5033837.496030.0000 
ALPAPIEK0837.4960 ALPAPIEKlight2+419.7553837.496030.0000 
EPQVYTLPPSR01285.6667 EPQVYTLPPSRlight1+1286.67391285.666730.0000 
EPQVYTLPPSR01285.6667 EPQVYTLPPSRlight2+643.84061285.666730.0000 
EPQVYTLPPSR01285.6667 EPQVYTLPPSRlight3+429.56281285.666730.0000 
EPQVYTLPPSR01285.6667 EPQVYTLPPSRlight4+322.42391285.666730.0000 
EEMTK0636.2789 EEMTKlight1+637.2862636.278930.0000 
EEMTK0636.2789 EEMTKlight2+319.1467636.278930.0000 
NQVSLTCLVK01160.6223 NQVSLTCLVKlight1+1161.62961160.622330.0000 
NQVSLTCLVK01160.6223 NQVSLTCLVKlight2+581.31841160.622330.0000 
NQVSLTCLVK01160.6223 NQVSLTCLVKlight3+387.88141160.622330.0000 
GFYPSDIAVEWESNGQPENNYK02543.1241 GFYPSDIAVEWESNGQPENNYKlight2+1272.56932543.124130.0000 
GFYPSDIAVEWESNGQPENNYK02543.1241 GFYPSDIAVEWESNGQPENNYKlight3+848.71532543.124130.0000 
GFYPSDIAVEWESNGQPENNYK02543.1241 GFYPSDIAVEWESNGQPENNYKlight4+636.78832543.124130.0000 
GFYPSDIAVEWESNGQPENNYK02544.1081 GFYPSDIAVEWESNGQPENNYKlight2+1273.06132544.108130.0000 
GFYPSDIAVEWESNGQPENNYK02544.1081 GFYPSDIAVEWESNGQPENNYKlight3+849.04332544.108130.0000 
GFYPSDIAVEWESNGQPENNYK02544.1081 GFYPSDIAVEWESNGQPENNYKlight4+637.03432544.108130.0000 
TTPPVLDSDGSFFLYSK01872.9145 TTPPVLDSDGSFFLYSKlight2+937.46451872.914530.0000 
TTPPVLDSDGSFFLYSK01872.9145 TTPPVLDSDGSFFLYSKlight3+625.31211872.914530.0000 
TTPPVLDSDGSFFLYSK01872.9145 TTPPVLDSDGSFFLYSKlight4+469.23591872.914530.0000 
LTVDK0574.3326 LTVDKlight1+575.3399574.332630.0000 
WQQGNVFSCSVMHEALHNHYTQK02800.2598 WQQGNVFSCSVMHEALHNHYTQKlight2+1401.13722800.259830.0000 
WQQGNVFSCSVMHEALHNHYTQK02800.2598 WQQGNVFSCSVMHEALHNHYTQKlight3+934.42722800.259830.0000 
WQQGNVFSCSVMHEALHNHYTQK02800.2598 WQQGNVFSCSVMHEALHNHYTQKlight4+701.07222800.259830.0000 
WQQGNVFSCSVMHEALHNHYTQK02816.2548 WQQGNVFSCSVMHEALHNHYTQKlight2+1409.13472816.254830.0000 
WQQGNVFSCSVMHEALHNHYTQK02816.2548 WQQGNVFSCSVMHEALHNHYTQKlight3+939.75892816.254830.0000 
WQQGNVFSCSVMHEALHNHYTQK02816.2548 WQQGNVFSCSVMHEALHNHYTQKlight4+705.07102816.254830.0000 
SLSLSPGK0787.4440 SLSLSPGKlight1+788.4512787.444030.0000 
SLSLSPGK0787.4440 SLSLSPGKlight2+394.7293787.444030.0000 
SLSLSPGK0659.3491 SLSLSPGKlight1+660.3563659.349130.0000 
SLSLSPGK0659.3491 SLSLSPGKlight2+330.6818659.349130.0000 
NISTmAb_LC  
Peptide Note/Annotations
Precursor Note/Annotations
DIQMTQSPSTLSASVGDR01891.8946 DIQMTQSPSTLSASVGDRlight2+946.95461891.894630.0000 
DIQMTQSPSTLSASVGDR01891.8946 DIQMTQSPSTLSASVGDRlight3+631.63881891.894630.0000 
DIQMTQSPSTLSASVGDR01891.8946 DIQMTQSPSTLSASVGDRlight4+473.98091891.894630.0000 
DIQMTQSPSTLSASVGDR01907.8895 DIQMTQSPSTLSASVGDRlight2+954.95201907.889530.0000 
DIQMTQSPSTLSASVGDR01907.8895 DIQMTQSPSTLSASVGDRlight3+636.97041907.889530.0000 
DIQMTQSPSTLSASVGDR01907.8895 DIQMTQSPSTLSASVGDRlight4+477.97961907.889530.0000 
VTITCSASSR01080.5234 VTITCSASSRlight1+1081.53061080.523430.0000 
VTITCSASSR01080.5234 VTITCSASSRlight2+541.26901080.523430.0000 
VTITCSASSR01080.5234 VTITCSASSRlight3+361.18171080.523430.0000 
VGYMHWYQQKPGK01620.7871 VGYMHWYQQKPGKlight1+1621.79441620.787130.0000 
VGYMHWYQQKPGK01620.7871 VGYMHWYQQKPGKlight2+811.40081620.787130.0000 
VGYMHWYQQKPGK01620.7871 VGYMHWYQQKPGKlight3+541.26961620.787130.0000 
VGYMHWYQQKPGK01620.7871 VGYMHWYQQKPGKlight4+406.20411620.787130.0000 
VGYMHWYQQKPGK01636.7820 VGYMHWYQQKPGKlight1+1637.78931636.782030.0000 
VGYMHWYQQKPGK01636.7820 VGYMHWYQQKPGKlight2+819.39831636.782030.0000 
VGYMHWYQQKPGK01636.7820 VGYMHWYQQKPGKlight3+546.60131636.782030.0000 
VGYMHWYQQKPGK01636.7820 VGYMHWYQQKPGKlight4+410.20281636.782030.0000 
LLIYDTSK0951.5277 LLIYDTSKlight1+952.5350951.527730.0000 
LLIYDTSK0951.5277 LLIYDTSKlight2+476.7711951.527730.0000 
LLIYDTSK0951.5277 LLIYDTSKlight3+318.1832951.527730.0000 
LASGVPSR0785.4396 LASGVPSRlight1+786.4468785.439630.0000 
LASGVPSR0785.4396 LASGVPSRlight2+393.7271785.439630.0000 
FSGSGSGTEFTLTISSLQPDDFATYYCFQGSGYPFTFGGGTK04481.9951 FSGSGSGTEFTLTISSLQPDDFATYYCFQGSGYPFTFGGGTKlight3+1495.00564481.995130.0000 
FSGSGSGTEFTLTISSLQPDDFATYYCFQGSGYPFTFGGGTK04481.9951 FSGSGSGTEFTLTISSLQPDDFATYYCFQGSGYPFTFGGGTKlight4+1121.50604481.995130.0000 
TVAAPSVFIFPPSDEQLK01945.0197 TVAAPSVFIFPPSDEQLKlight2+973.51711945.019730.0000 
TVAAPSVFIFPPSDEQLK01945.0197 TVAAPSVFIFPPSDEQLKlight3+649.34721945.019730.0000 
TVAAPSVFIFPPSDEQLK01945.0197 TVAAPSVFIFPPSDEQLKlight4+487.26221945.019730.0000 
SGTASVVCLLNNFYPR01796.8880 SGTASVVCLLNNFYPRlight2+899.45131796.888030.0000 
SGTASVVCLLNNFYPR01796.8880 SGTASVVCLLNNFYPRlight3+599.96991796.888030.0000 
SGTASVVCLLNNFYPR01796.8880 SGTASVVCLLNNFYPRlight4+450.22931796.888030.0000 
VDNALQSGNSQESVTEQDSK02134.9614 VDNALQSGNSQESVTEQDSKlight2+1068.48802134.961430.0000 
VDNALQSGNSQESVTEQDSK02134.9614 VDNALQSGNSQESVTEQDSKlight3+712.66112134.961430.0000 
VDNALQSGNSQESVTEQDSK02134.9614 VDNALQSGNSQESVTEQDSKlight4+534.74762134.961430.0000 
DSTYSLSSTLTLSK01501.7512 DSTYSLSSTLTLSKlight1+1502.75841501.751230.0000 
DSTYSLSSTLTLSK01501.7512 DSTYSLSSTLTLSKlight2+751.88291501.751230.0000 
DSTYSLSSTLTLSK01501.7512 DSTYSLSSTLTLSKlight3+501.59101501.751230.0000 
DSTYSLSSTLTLSK01501.7512 DSTYSLSSTLTLSKlight4+376.44511501.751230.0000 
ADYEK0624.2755 ADYEKlight1+625.2828624.275530.0000 
ADYEK0624.2755 ADYEKlight2+313.1450624.275530.0000 
VYACEVTHQGLSSPVTK01874.9196 VYACEVTHQGLSSPVTKlight2+938.46711874.919630.0000 
VYACEVTHQGLSSPVTK01874.9196 VYACEVTHQGLSSPVTKlight3+625.98051874.919630.0000 
VYACEVTHQGLSSPVTK01874.9196 VYACEVTHQGLSSPVTKlight4+469.73721874.919630.0000