View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MDLQVQIIXFLLISVTVIMSRGENVLTQSPAIMAASLGQKVTMTCSASSSVSSSYLHWYQQKSGASPKPLIHRTSNLASGVPARFSGSGSGTSYSLTISS
1
101111121
VEAEDDATYYCQQWSGYPFGSGTKLEIKR
Features
DescriptionIg kappa chain V-IV region S107B
Gene name-
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P01680
KV4A1_MOUSE
none loaded none loaded GO:0003823
Display Chart Settings
 

Peak Areas

Retention Times