sasp_panel_all_inducers_2019-02-26_11-18-00.sky.zip

SASP_Atlas_Buck
Protein Note/Annotations
 
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2
Peptide Note/Annotations
Precursor Note/Annotations
ANLNALDR0885.4668 ANLNALDRlight2+443.7407885.46681316.2172 
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight4+539.78942155.12871322.7930 
AGFAGDDAPR0975.4410 AGFAGDDAPRlight2+488.7278975.44101317.5668 
AVFPSIVGR0944.5444 AVFPSIVGRlight2+473.2795944.54441317.1034 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight2+599.85641197.69821320.9007 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight3+400.24001197.69821317.4901 
RGILTLK1799.5280 RGILTLKlight2+400.7713799.52801314.9281 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight2+758.37821514.74191325.6563 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight3+505.92121514.74191321.5060 
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight3+653.35801957.05201327.1086 
RLDLAGR1799.4664 RLDLAGRlight2+400.7405799.46641314.9272 
EIVRDIKEK21128.6503 EIVRDIKEKlight2+565.33241128.65031319.8650 
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight3+860.07322577.19791334.9638 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight2+895.94961789.88461329.7835 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight3+597.63551789.88461324.9911 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight3+698.69202093.05421328.8313 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight4+524.27082093.05421322.2033 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight4+902.66293606.62261336.5822 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight5+722.33183606.62261329.7296 
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight4+826.87063303.45311333.7021 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight2+822.90251643.79031327.5921 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight3+548.93741643.79031323.1406 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight4+411.95491643.79031317.9353 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight2+758.85501515.69541325.6706 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight3+506.23911515.69541321.5181 
sp|O00151|PDLI1_HUMAN PDZ and LIM domain protein 1 OS=Homo sapiens GN=PDLIM1 PE=1 SV=4
Peptide Note/Annotations
Precursor Note/Annotations
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight2+815.45161628.88861327.3685 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight3+543.97011628.88861322.9519 
DFEQPLAISR01174.5982 DFEQPLAISRlight2+588.30641174.59821320.5542 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3+1104.86983311.58741344.2661 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight4+828.90413311.58741333.7794 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3+1110.20143327.58241344.4687 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight4+832.90293327.58241333.9313 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight2+781.42201560.82941326.3477 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight3+521.28371560.82941322.0898 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight2+660.83251319.65031322.7300 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight3+440.89071319.65031319.0348 
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight3+627.99881880.97451326.1450 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight2+700.88031399.74601323.9314 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight3+467.58931399.74601320.0494 
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight2+622.82971243.64491321.5899 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2+1052.02362102.03271334.4657 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight3+701.68482102.03271328.9450 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight4+526.51552102.03271322.2886 
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight4+530.51422118.02761322.4405 
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight2+799.87761597.74061326.9013 
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight2+791.88011581.74571326.6614 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3+1034.49853100.47381341.5919 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight4+776.12573100.47381331.7738 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight3+887.45952659.35661336.0045 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight4+665.84642659.35661327.5832 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3+1132.57413394.70051345.3188 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight4+849.68243394.70051334.5689 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight5+679.94743394.70051328.1190 
PLDHAQPPSSLVIDK01615.8570 PLDHAQPPSSLVIDKlight3+539.62631615.85701322.7868 
QELNEPPKQSTSFLVLQEILESEEK12914.4811 QELNEPPKQSTSFLVLQEILESEEKlight3+972.50102914.48111339.2360 
QELNEPPK0953.4818 QELNEPPKlight2+477.7482953.48181317.2374 
QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFR23969.9960 QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRlight4+993.50633969.99601340.0342 
QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFR23969.9960 QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRlight5+795.00653969.99601332.4912 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight3+1012.51553034.52471340.7566 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight4+759.63853034.52471331.1473 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight5+607.91223034.52471325.3817 
QSTSFLVLQEILESEEK01979.0099 QSTSFLVLQEILESEEKlight2+990.51221979.00991332.6204 
QSTSFLVLQEILESEEK01979.0099 QSTSFLVLQEILESEEKlight3+660.67721979.00991327.3867 
VAASIGNAQK0957.5243 VAASIGNAQKlight2+479.7694957.52431317.2981 
CGTGIVGVFVK01135.6060 CGTGIVGVFVKlight2+568.81031135.60601319.9693 
HRHPECYVCTDCGTNLK12145.9143 HRHPECYVCTDCGTNLKlight3+716.31202145.91431329.5009 
HRHPECYVCTDCGTNLK12145.9143 HRHPECYVCTDCGTNLKlight4+537.48582145.91431322.7055 
HPECYVCTDCGTNLK01852.7542 HPECYVCTDCGTNLKlight2+927.38441852.75421330.7265 
HPECYVCTDCGTNLK01852.7542 HPECYVCTDCGTNLKlight3+618.59201852.75421325.7875 
QKGHFFVEDQIYCEK11926.8934 QKGHFFVEDQIYCEKlight3+643.30511926.89341326.7266 
GHFFVEDQIYCEK01670.7399 GHFFVEDQIYCEKlight2+836.37721670.73991327.9963 
GHFFVEDQIYCEK01670.7399 GHFFVEDQIYCEKlight3+557.92061670.73991323.4820 
ERVTPPEGYEVVTVFPK11946.0149 ERVTPPEGYEVVTVFPKlight3+649.67891946.01491326.9688 
VTPPEGYEVVTVFPK01660.8712 VTPPEGYEVVTVFPKlight2+831.44291660.87121327.8483 
VTPPEGYEVVTVFPK01660.8712 VTPPEGYEVVTVFPKlight3+554.63101660.87121323.3570 
sp|O00299|CLIC1_HUMAN Chloride intracellular channel protein 1 OS=Homo sapiens GN=CLIC1 PE=1 SV=4
Peptide Note/Annotations
Precursor Note/Annotations
IGNCPFSQR01077.5026 IGNCPFSQRlight2+539.75861077.50261319.0978 
IGNCPFSQRLFMVLWLKGVTFNVTTVDTK23370.7570 IGNCPFSQRLFMVLWLKGVTFNVTTVDTKlight4+843.69653370.75701334.3415 
LFMVLWLK01048.6143 LFMVLWLKlight2+525.31441048.61431318.6644 
LFMVLWLK01064.6093 LFMVLWLKlight2+533.31191064.60931318.9044 
GVTFNVTTVDTK01280.6612 GVTFNVTTVDTKlight2+641.33791280.66121322.1451 
GVTFNVTTVDTK01280.6612 GVTFNVTTVDTKlight3+427.89441280.66121318.5410 
GVTFNVTTVDTKR11436.7623 GVTFNVTTVDTKRlight2+719.38841436.76231324.4867 
GVTFNVTTVDTKR11436.7623 GVTFNVTTVDTKRlight3+479.92811436.76231320.5183 
LCPGGQLPFLLYGTEVHTDTNK02459.2155 LCPGGQLPFLLYGTEVHTDTNKlight3+820.74582459.21551333.4693 
LCPGGQLPFLLYGTEVHTDTNK02459.2155 LCPGGQLPFLLYGTEVHTDTNKlight4+615.81112459.21551325.6818 
LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPK24401.2178 LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKlight4+1101.31174401.21781344.1308 
LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPK24401.2178 LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKlight5+881.25084401.21781335.7685 
IEEFLEAVLCPPR01571.8018 IEEFLEAVLCPPRlight2+786.90821571.80181326.5122 
IEEFLEAVLCPPR01571.8018 IEEFLEAVLCPPRlight3+524.94121571.80181322.2288 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight2+981.01371960.01281332.3354 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight3+654.34491960.01281327.1461 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight4+491.01051960.01281320.9394 
LAALNPESNTAGLDIFAK01843.9680 LAALNPESNTAGLDIFAKlight2+922.99131843.96801330.5947 
LAALNPESNTAGLDIFAK01843.9680 LAALNPESNTAGLDIFAKlight3+615.66331843.96801325.6762 
NSNPALNDNLEK01327.6368 NSNPALNDNLEKlight2+664.82571327.63681322.8498 
NSNPALNDNLEKGLLK11738.9214 NSNPALNDNLEKGLLKlight2+870.46801738.92141329.0190 
ALKVLDNYLTSPLPEEVDETSAEDEGVSQR13303.5994 ALKVLDNYLTSPLPEEVDETSAEDEGVSQRlight3+1102.20713303.59941344.1649 
ALKVLDNYLTSPLPEEVDETSAEDEGVSQR13303.5994 ALKVLDNYLTSPLPEEVDETSAEDEGVSQRlight4+826.90713303.59941333.7035 
VLDNYLTSPLPEEVDETSAEDEGVSQR02991.3833 VLDNYLTSPLPEEVDETSAEDEGVSQRlight3+998.13502991.38331340.2101 
VLDNYLTSPLPEEVDETSAEDEGVSQR02991.3833 VLDNYLTSPLPEEVDETSAEDEGVSQRlight4+748.85312991.38331330.7374 
VLDNYLTSPLPEEVDETSAEDEGVSQRK13119.4782 VLDNYLTSPLPEEVDETSAEDEGVSQRKlight3+1040.83343119.47821341.8327 
VLDNYLTSPLPEEVDETSAEDEGVSQRK13119.4782 VLDNYLTSPLPEEVDETSAEDEGVSQRKlight4+780.87683119.47821331.9543 
KFLDGNELTLADCNLLPK12060.0612 KFLDGNELTLADCNLLPKlight2+1031.03792060.06121333.8361 
KFLDGNELTLADCNLLPK12060.0612 KFLDGNELTLADCNLLPKlight3+687.69442060.06121328.4134 
FLDGNELTLADCNLLPK01931.9663 FLDGNELTLADCNLLPKlight2+966.99041931.96631331.9147 
FLDGNELTLADCNLLPK01931.9663 FLDGNELTLADCNLLPKlight3+644.99601931.96631326.7908 
LHIVQVVCK01094.6270 LHIVQVVCKlight2+548.32081094.62701319.3546 
LHIVQVVCKK11222.7220 LHIVQVVCKKlight2+612.36831222.72201321.2760 
LHIVQVVCKK11222.7220 LHIVQVVCKKlight3+408.58131222.72201317.8071 
YRGFTIPEAFR11355.6986 YRGFTIPEAFRlight2+678.85661355.69861323.2707 
YRGFTIPEAFR11355.6986 YRGFTIPEAFRlight3+452.90681355.69861319.4915 
GFTIPEAFR01036.5342 GFTIPEAFRlight2+519.27441036.53421318.4832 
YLSNAYAREEFASTCPDDEEIELAYEQVAK13510.5773 YLSNAYAREEFASTCPDDEEIELAYEQVAKlight3+1171.19973510.57731346.7866 
YLSNAYAREEFASTCPDDEEIELAYEQVAK13510.5773 YLSNAYAREEFASTCPDDEEIELAYEQVAKlight4+878.65163510.57731335.6698 
YLSNAYAR0956.4716 YLSNAYARlight2+479.2431956.47161317.2823 
EEFASTCPDDEEIELAYEQVAK02572.1163 EEFASTCPDDEEIELAYEQVAKlight3+858.37942572.11631334.8994 
EEFASTCPDDEEIELAYEQVAK02572.1163 EEFASTCPDDEEIELAYEQVAKlight4+644.03632572.11631326.7544 
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3
Peptide Note/Annotations
Precursor Note/Annotations
SALYSPSDPLTLLQADTVR02046.0633 SALYSPSDPLTLLQADTVRlight2+1024.03892046.06331333.6262 
SALYSPSDPLTLLQADTVR02046.0633 SALYSPSDPLTLLQADTVRlight3+683.02842046.06331328.2361 
AWRPALYLAALDCAEETNSAVCR02636.2475 AWRPALYLAALDCAEETNSAVCRlight3+879.75652636.24751335.7117 
AWRPALYLAALDCAEETNSAVCR02636.2475 AWRPALYLAALDCAEETNSAVCRlight4+660.06922636.24751327.3636 
DFNIPGFPTVR01261.6455 DFNIPGFPTVRlight2+631.83001261.64551321.8599 
NGSGAVFPVAGADVQTLR01757.9060 NGSGAVFPVAGADVQTLRlight2+879.96031757.90601329.3038 
LEEIDGFFAR01195.5873 LEEIDGFFARlight2+598.80091195.58731320.8690 
NNEEYLALIFEK01481.7402 NNEEYLALIFEKlight2+741.87741481.74021325.1613 
RVLNTEANVVR11269.7153 RVLNTEANVVRlight2+635.86491269.71531321.9809 
VLNTEANVVR01113.6142 VLNTEANVVRlight2+557.81441113.61421319.6394 
KFGVTDFPSCYLLFR11848.9233 KFGVTDFPSCYLLFRlight3+617.31501848.92331325.7390 
FGVTDFPSCYLLFR01720.8283 FGVTDFPSCYLLFRlight2+861.42141720.82831328.7476 
VPVLMESR0929.5004 VPVLMESRlight2+465.7575929.50041316.8777 
SFYTAYLQR01147.5662 SFYTAYLQRlight2+574.79041147.56621320.1487 
KVNWIGCQGSEPHFR11813.8682 KVNWIGCQGSEPHFRlight4+454.47431813.86821319.5510 
GYVHYFFGCR01304.5761 GYVHYFFGCRlight3+435.86601304.57611318.8439 
DCASHFEQMAAASMHR01863.7451 DCASHFEQMAAASMHRlight3+622.25561863.74511325.9267 
DCASHFEQMAAASMHR01847.7502 DCASHFEQMAAASMHRlight3+616.92401847.75021325.7241 
DCASHFEQMAAASMHR01847.7502 DCASHFEQMAAASMHRlight4+462.94481847.75021319.8729 
VGSPNAAVLWLWSSHNR01892.9646 VGSPNAAVLWLWSSHNRlight3+631.99551892.96461326.2968 
LAGAPSEDPQFPK01355.6721 LAGAPSEDPQFPKlight2+678.84331355.67211323.2703 
ELCSACHNER01274.5132 ELCSACHNERlight3+425.84501274.51321318.4631 
LDVPVWDVEATLNFLK01857.9877 LDVPVWDVEATLNFLKlight2+930.00111857.98771330.8050 
AHFSPSNIILDFPAAGSAAR02041.0381 AHFSPSNIILDFPAAGSAARlight2+1021.52632041.03811333.5508 
AHFSPSNIILDFPAAGSAAR02041.0381 AHFSPSNIILDFPAAGSAARlight3+681.35332041.03811328.1724 
AHFSPSNIILDFPAAGSAAR02041.0381 AHFSPSNIILDFPAAGSAARlight4+511.26682041.03811321.7091 
DVQNVAAAPELAMGALELESR02183.0892 DVQNVAAAPELAMGALELESRlight3+728.70372183.08921329.9717 
AAPGQEPPEHMAELQR01759.8312 AAPGQEPPEHMAELQRlight2+880.92291759.83121329.3327 
DTGAALLAESR01102.5619 DTGAALLAESRlight2+552.28821102.56191319.4736 
sp|O00468|AGRIN_HUMAN Agrin OS=Homo sapiens GN=AGRN PE=1 SV=5
Peptide Note/Annotations
Precursor Note/Annotations
ESLLDGGNKVVISGFGDPLICDNQVSTGDTR13262.5776 ESLLDGGNKVVISGFGDPLICDNQVSTGDTRlight3+1088.53313262.57761343.6453 
VVISGFGDPLICDNQVSTGDTR02349.1271 VVISGFGDPLICDNQVSTGDTRlight2+1175.57082349.12711338.1721 
VVISGFGDPLICDNQVSTGDTR02349.1271 VVISGFGDPLICDNQVSTGDTRlight3+784.04962349.12711332.0749 
IFFVNPAPPYLWPAHK01896.0087 IFFVNPAPPYLWPAHKlight3+633.01021896.00871326.3354 
GMLCGFGAVCEPNAEGPGR01977.8495 GMLCGFGAVCEPNAEGPGRlight2+989.93201977.84951332.6030 
KSPCPSVVAPVCGSDASTYSNECELQR12997.3267 KSPCPSVVAPVCGSDASTYSNECELQRlight3+1000.11622997.32671340.2854 
SADGLTASCLCPATCR01738.7437 SADGLTASCLCPATCRlight2+870.37911738.74371329.0164 
GAPEGTVCGSDGADYPGECQLLRR12564.1384 GAPEGTVCGSDGADYPGECQLLRRlight3+855.72012564.13841334.7984 
KFDGPCDPCQGALPDPSR12015.8829 KFDGPCDPCQGALPDPSRlight2+1008.94872015.88291333.1735 
KFDGPCDPCQGALPDPSR12015.8829 KFDGPCDPCQGALPDPSRlight3+672.96832015.88291327.8538 
SGQCQGRDQCPEPCRFNAVCLSR22781.1952 SGQCQGRDQCPEPCRFNAVCLSRlight4+696.30612781.19521328.7406 
SGQCQGRDQCPEPCR11833.7305 SGQCQGRDQCPEPCRlight3+612.25081833.73051325.5465 
DQCPEPCR01060.4066 DQCPEPCRlight2+531.21061060.40661118.8413 
VTCDGAYRPVCAQDGR01823.8043 VTCDGAYRPVCAQDGRlight3+608.94201823.80431325.4208 
TYDSDCWR01101.4186 TYDSDCWRlight2+551.71661101.41861319.4565 
HQGPCDQAPSPCLGVQCAFGATCAVK02815.2299 HQGPCDQAPSPCLGVQCAFGATCAVKlight3+939.41722815.22991337.9789 
FGALCEAETGR01209.5448 FGALCEAETGRlight2+605.77971209.54481321.0784 
EAACLQQTQIEEAR01645.7730 EAACLQQTQIEEARlight2+823.89381645.77301327.6218 
EAACLQQTQIEEAR01645.7730 EAACLQQTQIEEARlight3+549.59831645.77301323.1657 
GLYVAAQGACR01164.5710 GLYVAAQGACRlight2+583.29281164.57101320.4038 
VCGSDGVTYGNECQLK01785.7662 VCGSDGVTYGNECQLKlight2+893.89041785.76621329.7217 
ASCYNSALGCCSDGKTPSLDAEGSNCPATK13177.3107 ASCYNSALGCCSDGKTPSLDAEGSNCPATKlight3+1060.11093177.31071342.5652 
TPSLDAEGSNCPATK01546.6933 TPSLDAEGSNCPATKlight2+774.35391546.69331326.1356 
SELFGETAR01008.4876 SELFGETARlight2+505.25111008.48761318.0625 
SIESTLDDLFR01294.6405 SIESTLDDLFRlight2+648.32751294.64051322.3548 
AIVDVHFDPTTAFR01587.8045 AIVDVHFDPTTAFRlight2+794.90951587.80451326.7523 
AIVDVHFDPTTAFR01587.8045 AIVDVHFDPTTAFRlight3+530.27551587.80451322.4315 
AIVDVHFDPTTAFRAPDVAR12197.1280 AIVDVHFDPTTAFRAPDVARlight4+550.28932197.12801323.1920 
RPLQEHVR01033.5781 RPLQEHVRlight2+517.79631033.57811318.4389 
VLGAPVPAFEGR01211.6663 VLGAPVPAFEGRlight2+606.84041211.66631321.1102 
SFLAFPTLR01050.5862 SFLAFPTLRlight2+526.30041050.58621318.6940 
ALEPQGLLLYNGNAR01627.8682 ALEPQGLLLYNGNARlight2+814.94141627.86821327.3532 
ALEPQGLLLYNGNAR01627.8682 ALEPQGLLLYNGNARlight3+543.63001627.86821322.9389 
GKDFLALALLDGR11387.7823 GKDFLALALLDGRlight3+463.60141387.78231319.8979 
DFLALALLDGR01202.6659 DFLALALLDGRlight2+602.34021202.66591320.9752 
FDTGSGPAVLTSAVPVEPGQWHRLELSR13005.5359 FDTGSGPAVLTSAVPVEPGQWHRLELSRlight4+752.39133005.53591330.8719 
FDTGSGPAVLTSAVPVEPGQWHR02407.1921 FDTGSGPAVLTSAVPVEPGQWHRlight3+803.40462407.19211332.8104 
LLDVNNQRLELGIGPGAATR12106.1546 LLDVNNQRLELGIGPGAATRlight2+1054.08462106.15461334.5275 
LLDVNNQRLELGIGPGAATR12106.1546 LLDVNNQRLELGIGPGAATRlight3+703.05882106.15461328.9972 
LLDVNNQR0970.5196 LLDVNNQRlight2+486.2671970.51961317.4930 
LELGIGPGAATR01153.6455 LELGIGPGAATRlight2+577.83001153.64551320.2399 
GSGVGECGDHPCLPNPCHGGAPCQNLEAGR03159.3128 GSGVGECGDHPCLPNPCHGGAPCQNLEAGRlight4+790.83553159.31281332.3327 
VGPTCADEKSPCQPNPCHGAAPCR12665.1254 VGPTCADEKSPCQPNPCHGAAPCRlight4+667.28862665.12541327.6380 
VLPEGGAQCECPLGR01641.7603 VLPEGGAQCECPLGRlight2+821.88741641.76031327.5616 
GPSGLLLYNGQK01245.6717 GPSGLLLYNGQKlight2+623.84311245.67171321.6203 
TDGKGDFVSLALRDR21648.8533 TDGKGDFVSLALRDRlight4+413.22061648.85331317.9834 
TDGKGDFVSLALR11377.7252 TDGKGDFVSLALRlight3+460.24901377.72521319.7705 
SREPVTLGAWTR11371.7259 SREPVTLGAWTRlight3+458.24921371.72591319.6945 
EPLYVGGAPDFSK01378.6769 EPLYVGGAPDFSKlight2+690.34571378.67691323.6154 
AAAVSSGFDGAIQLVSLGGR01874.9850 AAAVSSGFDGAIQLVSLGGRlight2+938.49981874.98501331.0600 
AAAVSSGFDGAIQLVSLGGR01874.9850 AAAVSSGFDGAIQLVSLGGRlight3+626.00231874.98501326.0691 
QLLTPEHVLR01204.6928 QLLTPEHVLRlight2+603.35371204.69281321.0056 
QLLTPEHVLR01204.6928 QLLTPEHVLRlight3+402.57151204.69281317.5787 
QVDVTSFAGHPCTR01573.7307 QVDVTSFAGHPCTRlight2+787.87261573.73071326.5412 
QVDVTSFAGHPCTR01573.7307 QVDVTSFAGHPCTRlight3+525.58421573.73071322.2532 
EAAYVCLCPGGFSGPHCEK02137.9020 EAAYVCLCPGGFSGPHCEKlight2+1069.95832137.90201335.0037 
EAAYVCLCPGGFSGPHCEK02137.9020 EAAYVCLCPGGFSGPHCEKlight3+713.64132137.90201329.3994 
SAGDVDTLAFDGR01322.6103 SAGDVDTLAFDGRlight2+662.31241322.61031322.7744 
ALQSNHFELSLR01413.7365 ALQSNHFELSLRlight3+472.25281413.73651320.2266 
TEATQGLVLWSGK01388.7300 TEATQGLVLWSGKlight2+695.37231388.73001323.7662 
EGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPK04408.2802 EGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKlight4+1103.07734408.28021344.1979 
AYGTGFVGCLRDVVVGR11824.9305 AYGTGFVGCLRDVVVGRlight3+609.31741824.93051325.4351 
AYGTGFVGCLR01199.5757 AYGTGFVGCLRlight2+600.79511199.57571320.9289 
HPLHLLEDAVTKPELRPCPTP02419.2682 HPLHLLEDAVTKPELRPCPTPlight4+605.82432419.26821325.3023 
sp|O00469|PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens GN=PLOD2 PE=1 SV=2
Peptide Note/Annotations
Precursor Note/Annotations
LLVITVATK0956.6270 LLVITVATKlight2+479.3208956.62701317.2846 
VLGQGEEWRGGDGINSIGGGQK12213.0825 VLGQGEEWRGGDGINSIGGGQKlight3+738.70142213.08251330.3517 
VLGQGEEWR01072.5302 VLGQGEEWRlight2+537.27241072.53021319.0232 
GGDGINSIGGGQK01158.5629 GGDGINSIGGGQKlight2+580.28871158.56291320.3137 
VVFAADGILWPDKR11585.8617 VVFAADGILWPDKRlight3+529.62781585.86171322.4069 
VVFAADGILWPDK01429.7606 VVFAADGILWPDKlight2+715.88761429.76061324.3816 
RYLNSGGFIGYAPYVNR11945.9799 RYLNSGGFIGYAPYVNRlight2+973.99721945.97991332.1249 
RYLNSGGFIGYAPYVNR11945.9799 RYLNSGGFIGYAPYVNRlight3+649.66721945.97991326.9684 
YLNSGGFIGYAPYVNR01789.8788 YLNSGGFIGYAPYVNRlight2+895.94671789.87881329.7834 
IVQQWNLQDNDDDQLFYTK02382.1128 IVQQWNLQDNDDDQLFYTKlight2+1192.06372382.11281338.6669 
IVQQWNLQDNDDDQLFYTK02382.1128 IVQQWNLQDNDDDQLFYTKlight3+795.04492382.11281332.4927 
VYIDPLKR11002.5862 VYIDPLKRlight2+502.30041002.58621317.9740 
CKIFQTLNGAVDEVVLKFENGK22508.3046 CKIFQTLNGAVDEVVLKFENGKlight4+628.08342508.30461326.1482 
IFQTLNGAVDEVVLK01644.9087 IFQTLNGAVDEVVLKlight2+823.46161644.90871327.6088 
IFQTLNGAVDEVVLK01644.9087 IFQTLNGAVDEVVLKlight3+549.31021644.90871323.1548 
IFQTLNGAVDEVVLKFENGK12220.1790 IFQTLNGAVDEVVLKFENGKlight2+1111.09682220.17901336.2379 
IFQTLNGAVDEVVLKFENGK12220.1790 IFQTLNGAVDEVVLKFENGKlight3+741.06702220.17901330.4415 
AKNTFYETLPVAINGNGPTK12134.1059 AKNTFYETLPVAINGNGPTKlight3+712.37592134.10591329.3513 
NTFYETLPVAINGNGPTK01934.9738 NTFYETLPVAINGNGPTKlight2+968.49421934.97381331.9598 
NTFYETLPVAINGNGPTK01934.9738 NTFYETLPVAINGNGPTKlight3+645.99851934.97381326.8289 
FLDILLTLDYPK01449.8119 FLDILLTLDYPKlight2+725.91321449.81191324.6824 
IVGPEENLSQAEAR01511.7580 IVGPEENLSQAEARlight2+756.88631511.75801325.6116 
IVGPEENLSQAEAR01511.7580 IVGPEENLSQAEARlight3+504.92661511.75801321.4682 
NMGMDFCRQDEK11529.6061 NMGMDFCRQDEKlight2+765.81031529.60611325.8793 
NMGMDFCR01029.3830 NMGMDFCRlight2+515.69881029.38301318.3760 
IIAPLVTR0881.5698 IIAPLVTRlight2+441.7922881.56981316.1588 
LWSNFWGALSPDGYYAR02001.9373 LWSNFWGALSPDGYYARlight2+1001.97602001.93731332.9643 
LWSNFWGALSPDGYYAR02001.9373 LWSNFWGALSPDGYYARlight3+668.31972001.93731327.6772 
SEDYVDIVQGNR01393.6474 SEDYVDIVQGNRlight2+697.83101393.64741323.8399 
VGVWNVPYMANVYLIK01864.9910 VGVWNVPYMANVYLIKlight2+933.50281864.99101330.9101 
VGVWNVPYMANVYLIK01864.9910 VGVWNVPYMANVYLIKlight3+622.67091864.99101325.9425 
VGVWNVPYMANVYLIK01880.9859 VGVWNVPYMANVYLIKlight2+941.50021880.98591331.1500 
VGVWNVPYMANVYLIK01880.9859 VGVWNVPYMANVYLIKlight3+628.00261880.98591326.1451 
DKLDPDMALCR11332.6166 DKLDPDMALCRlight3+445.21281332.61661319.1991 
IFTENIVEQPCPDVFWFPIFSEK02841.3724 IFTENIVEQPCPDVFWFPIFSEKlight3+948.13142841.37241338.3100 
ACDELVEEMEHYGK01708.7073 ACDELVEEMEHYGKlight3+570.57641708.70731323.9629 
ISGGYENVPTDDIHMK01790.8145 ISGGYENVPTDDIHMKlight3+597.94541790.81451325.0029 
ISGGYENVPTDDIHMK01774.8196 ISGGYENVPTDDIHMKlight2+888.41711774.81961329.5575 
ISGGYENVPTDDIHMK01774.8196 ISGGYENVPTDDIHMKlight3+592.61381774.81961324.8003 
QVDLENVWLHFIR01667.8784 QVDLENVWLHFIRlight2+834.94651667.87841327.9534 
QVDLENVWLHFIR01667.8784 QVDLENVWLHFIRlight3+556.96671667.87841323.4457 
EFIAPVTLK01016.5906 EFIAPVTLKlight2+509.30261016.59061318.1841 
VFAGYYTK0947.4753 VFAGYYTKlight2+474.7449947.47531317.1473 
GFALLNFVVK01106.6488 GFALLNFVVKlight2+554.33171106.64881319.5350 
SLRPHHDASTFTINIALNNVGEDFQGGGCK03254.5527 SLRPHHDASTFTINIALNNVGEDFQGGGCKlight4+814.64553254.55271333.2375 
SLRPHHDASTFTINIALNNVGEDFQGGGCK03254.5527 SLRPHHDASTFTINIALNNVGEDFQGGGCKlight5+651.91783254.55271327.0539 
LTHLHEGLPVK01242.7085 LTHLHEGLPVKlight2+622.36151242.70851321.5758 
LTHLHEGLPVK01242.7085 LTHLHEGLPVKlight3+415.24341242.70851318.0602 
YIAVSFIDP01023.5277 YIAVSFIDPlight2+512.77111023.52771318.2881 
sp|O14950|ML12B_HUMAN Myosin regulatory light chain 12B OS=Homo sapiens GN=MYL12B PE=1 SV=2
Peptide Note/Annotations
Precursor Note/Annotations
ATSNVFAMFDQSQIQEFK02089.9779 ATSNVFAMFDQSQIQEFKlight2+1045.99622089.97791334.2849 
ATSNVFAMFDQSQIQEFK02089.9779 ATSNVFAMFDQSQIQEFKlight3+697.66662089.97791328.7923 
ATSNVFAMFDQSQIQEFK02105.9728 ATSNVFAMFDQSQIQEFKlight2+1053.99372105.97281334.5248 
ATSNVFAMFDQSQIQEFK02105.9728 ATSNVFAMFDQSQIQEFKlight3+702.99822105.97281328.9949 
ATSNVFAMFDQSQIQEFKEAFNMIDQNR13308.5230 ATSNVFAMFDQSQIQEFKEAFNMIDQNRlight3+1103.84833308.52301344.2272 
EAFNMIDQNR01236.5557 EAFNMIDQNRlight2+619.28511236.55571321.4836 
EAFNMIDQNR01252.5506 EAFNMIDQNRlight2+627.28261252.55061321.7235 
EAFNMIDQNRDGFIDK11911.8785 EAFNMIDQNRDGFIDKlight2+956.94651911.87851331.6134 
EAFNMIDQNRDGFIDK11911.8785 EAFNMIDQNRDGFIDKlight3+638.30011911.87851326.5364 
EAFNMIDQNRDGFIDKEDLHDMLASLGK23221.5121 EAFNMIDQNRDGFIDKEDLHDMLASLGKlight4+806.38533221.51211332.9236 
EAFNMIDQNRDGFIDKEDLHDMLASLGK23221.5121 EAFNMIDQNRDGFIDKEDLHDMLASLGKlight5+645.30973221.51211326.8028 
EAFNMIDQNRDGFIDKEDLHDMLASLGK23237.5071 EAFNMIDQNRDGFIDKEDLHDMLASLGKlight4+810.38403237.50711333.0756 
DGFIDKEDLHDMLASLGK12002.9670 DGFIDKEDLHDMLASLGKlight2+1002.49082002.96701332.9797 
DGFIDKEDLHDMLASLGK12002.9670 DGFIDKEDLHDMLASLGKlight3+668.66292002.96701327.6902 
DGFIDKEDLHDMLASLGK12002.9670 DGFIDKEDLHDMLASLGKlight4+501.74902002.96701321.3475 
DGFIDKEDLHDMLASLGK12018.9619 DGFIDKEDLHDMLASLGKlight4+505.74782018.96191321.4994 
EDLHDMLASLGK01327.6442 EDLHDMLASLGKlight2+664.82941327.64421322.8499 
EDLHDMLASLGK01327.6442 EDLHDMLASLGKlight3+443.55531327.64421319.1361 
LNGTDPEDVIRNAFACFDEEATGTIQEDYLR13558.6209 LNGTDPEDVIRNAFACFDEEATGTIQEDYLRlight3+1187.21423558.62091347.3951 
LNGTDPEDVIRNAFACFDEEATGTIQEDYLR13558.6209 LNGTDPEDVIRNAFACFDEEATGTIQEDYLRlight4+890.66253558.62091336.1262 
LNGTDPEDVIR01227.6095 LNGTDPEDVIRlight2+614.81201227.60951321.3494 
NAFACFDEEATGTIQEDYLR02349.0219 NAFACFDEEATGTIQEDYLRlight2+1175.51822349.02191338.1705 
NAFACFDEEATGTIQEDYLR02349.0219 NAFACFDEEATGTIQEDYLRlight3+784.01462349.02191332.0736 
IQEDYLR0935.4712 IQEDYLRlight2+468.7429935.47121316.9673 
ELLTTMGDR01034.5066 ELLTTMGDRlight2+518.26061034.50661318.4528 
ELLTTMGDR01050.5016 ELLTTMGDRlight2+526.25811050.50161318.6927 
ELLTTMGDRFTDEEVDELYR12431.1213 ELLTTMGDRFTDEEVDELYRlight3+811.38102431.12131333.1135 
ELLTTMGDRFTDEEVDELYR12447.1162 ELLTTMGDRFTDEEVDELYRlight3+816.71272447.11621333.3161 
ELLTTMGDRFTDEEVDELYREAPIDK23084.4598 ELLTTMGDRFTDEEVDELYREAPIDKlight3+1029.16053084.45981341.3891 
ELLTTMGDRFTDEEVDELYREAPIDK23084.4598 ELLTTMGDRFTDEEVDELYREAPIDKlight4+772.12223084.45981331.6216 
ELLTTMGDRFTDEEVDELYREAPIDK23100.4547 ELLTTMGDRFTDEEVDELYREAPIDKlight4+776.12093100.45471331.7736 
FTDEEVDELYR01414.6252 FTDEEVDELYRlight2+708.31991414.62521324.1546 
FTDEEVDELYR01414.6252 FTDEEVDELYRlight3+472.54901414.62521320.2379 
FTDEEVDELYREAPIDK12067.9637 FTDEEVDELYREAPIDKlight2+1034.98912067.96371333.9547 
FTDEEVDELYREAPIDK12067.9637 FTDEEVDELYREAPIDKlight3+690.32852067.96371328.5135 
EAPIDKKGNFNYIEFTR22041.0269 EAPIDKKGNFNYIEFTRlight3+681.34962041.02691328.1723 
KGNFNYIEFTR11387.6885 KGNFNYIEFTRlight2+694.85151387.68851323.7505 
KGNFNYIEFTR11387.6885 KGNFNYIEFTRlight3+463.57011387.68851319.8967 
GNFNYIEFTR01259.5935 GNFNYIEFTRlight2+630.80401259.59351321.8291 
sp|O43399|TPD54_HUMAN Tumor protein D54 OS=Homo sapiens GN=TPD52L2 PE=1 SV=2
Peptide Note/Annotations
Precursor Note/Annotations
GLLSDSMTDVPVDTGVAAR01902.9357 GLLSDSMTDVPVDTGVAARlight2+952.47511902.93571331.4793 
GLLSDSMTDVPVDTGVAAR01902.9357 GLLSDSMTDVPVDTGVAARlight3+635.31921902.93571326.4231 
GLLSDSMTDVPVDTGVAAR01918.9306 GLLSDSMTDVPVDTGVAARlight2+960.47261918.93061331.7192 
TPAVEGLTEAEEEELR01771.8476 TPAVEGLTEAEEEELRlight2+886.93111771.84761329.5129 
TPAVEGLTEAEEEELR01771.8476 TPAVEGLTEAEEEELRlight3+591.62311771.84761324.7627 
TPAVEGLTEAEEEELRAELTK12314.1540 TPAVEGLTEAEEEELRAELTKlight2+1158.08432314.15401337.6475 
TPAVEGLTEAEEEELRAELTK12314.1540 TPAVEGLTEAEEEELRAELTKlight3+772.39192314.15401331.6319 
TPAVEGLTEAEEEELRAELTKVEEEIVTLR23382.7355 TPAVEGLTEAEEEELRAELTKVEEEIVTLRlight3+1128.58583382.73551345.1673 
TPAVEGLTEAEEEELRAELTKVEEEIVTLR23382.7355 TPAVEGLTEAEEEELRAELTKVEEEIVTLRlight4+846.69123382.73551334.4553 
TPAVEGLTEAEEEELRAELTKVEEEIVTLR23382.7355 TPAVEGLTEAEEEELRAELTKVEEEIVTLRlight5+677.55443382.73551328.0281 
VEEEIVTLR01086.5921 VEEEIVTLRlight2+544.30331086.59211319.2341 
LGLSTLGELK01029.6070 LGLSTLGELKlight2+515.81081029.60701318.3793 
LGLSTLGELKQNLSR11627.9257 LGLSTLGELKQNLSRlight3+543.64921627.92571322.9397 
SWHDVQVSSAYVK01504.7310 SWHDVQVSSAYVKlight2+753.37281504.73101325.5062 
SWHDVQVSSAYVK01504.7310 SWHDVQVSSAYVKlight3+502.58431504.73101321.3792 
TSEKLGEWNEK11319.6357 TSEKLGEWNEKlight3+440.88591319.63571319.0347 
LGEWNEK0874.4185 LGEWNEKlight2+438.2165874.41851316.0515 
VTQSDLYK0952.4866 VTQSDLYKlight2+477.2506952.48661317.2225 
VTQSDLYKK11080.5815 VTQSDLYKKlight2+541.29801080.58151319.1439 
KTQETLSQAGQK11317.6888 KTQETLSQAGQKlight2+659.85171317.68881322.7006 
KTQETLSQAGQK11317.6888 KTQETLSQAGQKlight3+440.23691317.68881319.0100 
TQETLSQAGQK01189.5939 TQETLSQAGQKlight2+595.80421189.59391320.7791 
TSAALSTVGSAISR01319.7045 TSAALSTVGSAISRlight2+660.85951319.70451322.7308 
TSAALSTVGSAISR01319.7045 TSAALSTVGSAISRlight3+440.90881319.70451319.0355 
TSAALSTVGSAISRK11447.7995 TSAALSTVGSAISRKlight3+483.60711447.79951320.6581 
VVGDRENGSDNLPSSAGSGDK12059.9407 VVGDRENGSDNLPSSAGSGDKlight3+687.65422059.94071328.4119 
VVGDRENGSDNLPSSAGSGDKPLSDPAPF12884.3475 VVGDRENGSDNLPSSAGSGDKPLSDPAPFlight3+962.45642884.34751338.8543 
VVGDRENGSDNLPSSAGSGDKPLSDPAPF12884.3475 VVGDRENGSDNLPSSAGSGDKPLSDPAPFlight4+722.09422884.34751329.7206 
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2
Peptide Note/Annotations
Precursor Note/Annotations
DLLLDPAWEK01198.6234 DLLLDPAWEKlight2+600.31901198.62341320.9146 
KTFTAWCNSHLRK21647.8304 KTFTAWCNSHLRKlight2+824.92251647.83041327.6527 
KTFTAWCNSHLRK21647.8304 KTFTAWCNSHLRKlight3+550.28411647.83041323.1918 
KTFTAWCNSHLRK21647.8304 KTFTAWCNSHLRKlight4+412.96491647.83041317.9737 
KTFTAWCNSHLR11519.7354 KTFTAWCNSHLRlight2+760.87501519.73541325.7313 
KTFTAWCNSHLR11519.7354 KTFTAWCNSHLRlight3+507.58571519.73541321.5693 
TFTAWCNSHLRK11519.7354 TFTAWCNSHLRKlight2+760.87501519.73541325.7313 
TFTAWCNSHLRK11519.7354 TFTAWCNSHLRKlight3+507.58571519.73541321.5693 
TFTAWCNSHLR01391.6405 TFTAWCNSHLRlight2+696.82751391.64051323.8098 
TFTAWCNSHLR01391.6405 TFTAWCNSHLRlight3+464.88741391.64051319.9467 
KAGTQIENIDEDFRDGLK22048.0174 KAGTQIENIDEDFRDGLKlight3+683.67982048.01741328.2608 
KAGTQIENIDEDFRDGLK22048.0174 KAGTQIENIDEDFRDGLKlight4+513.01162048.01741321.7754 
KAGTQIENIDEDFR11634.7900 KAGTQIENIDEDFRlight3+545.93731634.79001323.0266 
AGTQIENIDEDFRDGLK11919.9225 AGTQIENIDEDFRDGLKlight2+960.96851919.92251331.7341 
AGTQIENIDEDFRDGLK11919.9225 AGTQIENIDEDFRDGLKlight3+640.98141919.92251326.6383 
AGTQIENIDEDFR01506.6951 AGTQIENIDEDFRlight2+754.35481506.69511325.5356 
LMLLLEVISGER01371.7796 LMLLLEVISGERlight2+686.89711371.77961323.5119 
LMLLLEVISGERLPKPER12108.2027 LMLLLEVISGERLPKPERlight4+528.05802108.20271322.3472 
LMLLLEVISGER01387.7745 LMLLLEVISGERlight2+694.89451387.77451323.7518 
LMLLLEVISGERLPKPER12092.2078 LMLLLEVISGERLPKPERlight3+698.40992092.20781328.8206 
LMLLLEVISGERLPKPER12092.2078 LMLLLEVISGERLPKPERlight4+524.05922092.20781322.1953 
ALDFIASK0863.4753 ALDFIASKlight2+432.7449863.47531315.8873 
LVSIGAEEIVDGNAK01513.7988 LVSIGAEEIVDGNAKlight2+757.90671513.79881325.6422 
LVSIGAEEIVDGNAK01513.7988 LVSIGAEEIVDGNAKlight3+505.60691513.79881321.4941 
MTLGMIWTIILR01446.8091 MTLGMIWTIILRlight2+724.41181446.80911324.6374 
MTLGMIWTIILR01462.8040 MTLGMIWTIILRlight2+732.40931462.80401324.8773 
MTLGMIWTIILR01462.8040 MTLGMIWTIILRlight2+732.40931462.80401324.8773 
MTLGMIWTIILR01478.7989 MTLGMIWTIILRlight2+740.40671478.79891325.1172 
FAIQDISVEETSAK01536.7672 FAIQDISVEETSAKlight2+769.39091536.76721325.9867 
FAIQDISVEETSAK01536.7672 FAIQDISVEETSAKlight3+513.26301536.76721321.7850 
FAIQDISVEETSAKEGLLLWCQR12692.3531 FAIQDISVEETSAKEGLLLWCQRlight3+898.45832692.35311336.4224 
EGLLLWCQR01173.5965 EGLLLWCQRlight2+587.80551173.59651320.5392 
EGLLLWCQRK11301.6914 EGLLLWCQRKlight3+434.90441301.69141318.8074 
NVNVQNFHISWK01484.7524 NVNVQNFHISWKlight2+743.38351484.75241325.2065 
NVNVQNFHISWK01484.7524 NVNVQNFHISWKlight3+495.92481484.75241321.1261 
NVNVQNFHISWKDGLAFNALIHR12692.3986 NVNVQNFHISWKDGLAFNALIHRlight3+898.47352692.39861336.4230 
NVNVQNFHISWKDGLAFNALIHR12692.3986 NVNVQNFHISWKDGLAFNALIHRlight4+674.10692692.39861327.8971 
NVNVQNFHISWKDGLAFNALIHR12692.3986 NVNVQNFHISWKDGLAFNALIHRlight5+539.48702692.39861322.7815 
DGLAFNALIHR01225.6568 DGLAFNALIHRlight2+613.83571225.65681321.3201 
DGLAFNALIHR01225.6568 DGLAFNALIHRlight3+409.55951225.65681317.8443 
HRPELIEYDK01298.6619 HRPELIEYDKlight2+650.33821298.66191322.4151 
HRPELIEYDK01298.6619 HRPELIEYDKlight3+433.89461298.66191318.7690 
HRPELIEYDKLR11567.8471 HRPELIEYDKLRlight2+784.93081567.84711326.4529 
HRPELIEYDKLR11567.8471 HRPELIEYDKLRlight3+523.62301567.84711322.1787 
LRKDDPVTNLNNAFEVAEK22172.1175 LRKDDPVTNLNNAFEVAEKlight2+1087.06602172.11751335.5170 
LRKDDPVTNLNNAFEVAEK22172.1175 LRKDDPVTNLNNAFEVAEKlight3+725.04642172.11751329.8328 
LRKDDPVTNLNNAFEVAEK22172.1175 LRKDDPVTNLNNAFEVAEKlight4+544.03672172.11751322.9544 
KDDPVTNLNNAFEVAEK11902.9323 KDDPVTNLNNAFEVAEKlight2+952.47341902.93231331.4792 
KDDPVTNLNNAFEVAEK11902.9323 KDDPVTNLNNAFEVAEKlight3+635.31801902.93231326.4231 
KDDPVTNLNNAFEVAEKYLDIPK22632.3384 KDDPVTNLNNAFEVAEKYLDIPKlight3+878.45342632.33841335.6622 
KDDPVTNLNNAFEVAEKYLDIPK22632.3384 KDDPVTNLNNAFEVAEKYLDIPKlight4+659.09192632.33841327.3265 
DDPVTNLNNAFEVAEKYLDIPK12504.2435 DDPVTNLNNAFEVAEKYLDIPKlight3+835.75512504.24351334.0397 
DDPVTNLNNAFEVAEK01774.8374 DDPVTNLNNAFEVAEKlight2+888.42601774.83741329.5578 
DDPVTNLNNAFEVAEK01774.8374 DDPVTNLNNAFEVAEKlight3+592.61971774.83741324.8006 
MLDAEDIVNTARPDEK01831.8622 MLDAEDIVNTARPDEKlight2+916.93841831.86221330.4132 
MLDAEDIVNTARPDEK01831.8622 MLDAEDIVNTARPDEKlight3+611.62801831.86221325.5229 
MLDAEDIVNTAR01346.6500 MLDAEDIVNTARlight2+674.33231346.65001323.1350 
MLDAEDIVNTARPDEK01815.8673 MLDAEDIVNTARPDEKlight2+908.94091815.86731330.1732 
MLDAEDIVNTARPDEK01815.8673 MLDAEDIVNTARPDEKlight3+606.29641815.86731325.3203 
AIMTYVSSFYHAFSGAQK02022.9509 AIMTYVSSFYHAFSGAQKlight2+1012.48282022.95091333.2795 
AIMTYVSSFYHAFSGAQK02022.9509 AIMTYVSSFYHAFSGAQKlight3+675.32432022.95091327.9433 
AIMTYVSSFYHAFSGAQK02006.9560 AIMTYVSSFYHAFSGAQKlight2+1004.48532006.95601333.0396 
AIMTYVSSFYHAFSGAQK02006.9560 AIMTYVSSFYHAFSGAQKlight3+669.99262006.95601327.7407 
AIMTYVSSFYHAFSGAQK02006.9560 AIMTYVSSFYHAFSGAQKlight4+502.74632006.95601321.3854 
VLAVNQENEHLMEDYEKLASDLLEWIR13256.6074 VLAVNQENEHLMEDYEKLASDLLEWIRlight4+815.15913256.60741333.2570 
VLAVNQENEHLMEDYEK02059.9521 VLAVNQENEHLMEDYEKlight2+1030.98332059.95211333.8345 
VLAVNQENEHLMEDYEK02059.9521 VLAVNQENEHLMEDYEKlight3+687.65802059.95211328.4120 
VLAVNQENEHLMEDYEKLASDLLEWIRR23428.7035 VLAVNQENEHLMEDYEKLASDLLEWIRRlight5+686.74803428.70351328.3774 
VLAVNQENEHLMEDYEK02075.9470 VLAVNQENEHLMEDYEKlight3+692.98962075.94701328.6146 
VLAVNQENEHLMEDYEKLASDLLEWIRR23412.7085 VLAVNQENEHLMEDYEKLASDLLEWIRRlight4+854.18443412.70851334.7400 
VLAVNQENEHLMEDYEKLASDLLEWIRR23412.7085 VLAVNQENEHLMEDYEKLASDLLEWIRRlight5+683.54903412.70851328.2559 
LASDLLEWIRR11370.7670 LASDLLEWIRRlight2+686.39081370.76701323.4967 
LASDLLEWIRR11370.7670 LASDLLEWIRRlight3+457.92961370.76701319.6823 
LASDLLEWIR01214.6659 LASDLLEWIRlight2+608.34021214.66591321.1552 
LASDLLEWIR01214.6659 LASDLLEWIRlight3+405.89591214.66591317.7050 
RTIPWLEDRVPQK21636.9049 RTIPWLEDRVPQKlight3+546.64231636.90491323.0534 
TIPWLEDRVPQK11480.8038 TIPWLEDRVPQKlight2+741.40921480.80381325.1473 
TIPWLEDRVPQK11480.8038 TIPWLEDRVPQKlight3+494.60851480.80381321.0761 
TIPWLEDR01028.5291 TIPWLEDRlight2+515.27181028.52911118.3632 
TIQEMQQK01020.4910 TIQEMQQKlight2+511.25281020.49101318.2426 
TIQEMQQK01004.4961 TIQEMQQKlight2+503.25531004.49611318.0027 
VQEKCQLEINFNTLQTK12092.0623 VQEKCQLEINFNTLQTKlight3+698.36142092.06231328.8187 
CQLEINFNTLQTK01607.7977 CQLEINFNTLQTKlight2+804.90611607.79771327.0522 
CQLEINFNTLQTK01607.7977 CQLEINFNTLQTKlight3+536.93991607.79771322.6847 
LSNRPAFMPSEGK01448.7082 LSNRPAFMPSEGKlight2+725.36141448.70821324.6658 
LSNRPAFMPSEGK01448.7082 LSNRPAFMPSEGKlight3+483.91001448.70821320.6696 
LSNRPAFMPSEGK01432.7133 LSNRPAFMPSEGKlight2+717.36391432.71331324.4259 
LSNRPAFMPSEGK01432.7133 LSNRPAFMPSEGKlight3+478.57841432.71331320.4670 
MVSDINNGWQHLEQAEK01997.9265 MVSDINNGWQHLEQAEKlight2+999.97051997.92651332.9041 
MVSDINNGWQHLEQAEK01997.9265 MVSDINNGWQHLEQAEKlight3+666.98281997.92651327.6263 
MVSDINNGWQHLEQAEKGYEEWLLNEIR13400.6146 MVSDINNGWQHLEQAEKGYEEWLLNEIRlight4+851.16093400.61461334.6251 
MVSDINNGWQHLEQAEK02013.9214 MVSDINNGWQHLEQAEKlight2+1007.96802013.92141333.1440 
MVSDINNGWQHLEQAEK02013.9214 MVSDINNGWQHLEQAEKlight3+672.31442013.92141327.8289 
MVSDINNGWQHLEQAEKGYEEWLLNEIR13416.6096 MVSDINNGWQHLEQAEKGYEEWLLNEIRlight4+855.15973416.60961334.7771 
GYEEWLLNEIR01420.6987 GYEEWLLNEIRlight2+711.35661420.69871324.2457 
GYEEWLLNEIR01420.6987 GYEEWLLNEIRlight3+474.57351420.69871320.3148 
GYEEWLLNEIRR11576.7998 GYEEWLLNEIRRlight2+789.40721576.79981326.5872 
GYEEWLLNEIRR11576.7998 GYEEWLLNEIRRlight3+526.60721576.79981322.2921 
LERLDHLAEK11222.6670 LERLDHLAEKlight2+612.34081222.66701321.2752 
LERLDHLAEK11222.6670 LERLDHLAEKlight3+408.56291222.66701317.8064 
LDHLAEK0824.4392 LDHLAEKlight2+413.2269824.43921315.3018 
QKASIHEAWTDGKEAMLK22042.0255 QKASIHEAWTDGKEAMLKlight3+681.68242042.02551328.1849 
ASIHEAWTDGK01213.5728 ASIHEAWTDGKlight2+607.79371213.57281321.1388 
ASIHEAWTDGK01213.5728 ASIHEAWTDGKlight3+405.53151213.57281317.6912 
ASIHEAWTDGKEAMLK11785.8720 ASIHEAWTDGKEAMLKlight3+596.29791785.87201324.9403 
ASIHEAWTDGKEAMLK11785.8720 ASIHEAWTDGKEAMLKlight4+447.47531785.87201319.2851 
HRDYETATLSDIK11547.7580 HRDYETATLSDIKlight2+774.88631547.75801326.1516 
HRDYETATLSDIK11547.7580 HRDYETATLSDIKlight3+516.92661547.75801321.9242 
DYETATLSDIK01254.5980 DYETATLSDIKlight2+628.30631254.59801321.7542 
KHEAFESDLAAHQDR11752.8180 KHEAFESDLAAHQDRlight2+877.41631752.81801329.2275 
KHEAFESDLAAHQDR11752.8180 KHEAFESDLAAHQDRlight3+585.27991752.81801324.5216 
KHEAFESDLAAHQDR11752.8180 KHEAFESDLAAHQDRlight4+439.21181752.81801318.9710 
KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTR24639.1964 KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRlight4+1160.80644639.19641346.3916 
KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTR24639.1964 KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRlight5+928.84664639.19641337.5772 
KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTR24639.1964 KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRlight6+774.20674639.19641331.7009 
KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTR24639.1964 KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRlight7+663.74964639.19641327.5035 
HEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTR14511.1014 HEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRlight4+1128.78264511.10141345.1747 
HEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTR14511.1014 HEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRlight5+903.22764511.10141336.6036 
HEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTR14511.1014 HEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRlight6+752.85754511.10141330.8896 
HEAFESDLAAHQDR01624.7230 HEAFESDLAAHQDRlight2+813.36881624.72301327.3061 
HEAFESDLAAHQDR01624.7230 HEAFESDLAAHQDRlight3+542.58161624.72301322.8991 
HEAFESDLAAHQDR01624.7230 HEAFESDLAAHQDRlight4+407.18801624.72301317.7541 
VEQIAAIAQELNELDYYDSHNVNTR02904.3890 VEQIAAIAQELNELDYYDSHNVNTRlight3+969.13692904.38901339.1082 
VEQIAAIAQELNELDYYDSHNVNTR02904.3890 VEQIAAIAQELNELDYYDSHNVNTRlight4+727.10452904.38901329.9110 
ICDQWDALGSLTHSR01757.8155 ICDQWDALGSLTHSRlight2+879.91501757.81551329.3025 
ICDQWDALGSLTHSR01757.8155 ICDQWDALGSLTHSRlight3+586.94581757.81551324.5849 
ICDQWDALGSLTHSRR11913.9166 ICDQWDALGSLTHSRRlight3+638.97951913.91661326.5622 
ICDQWDALGSLTHSRR11913.9166 ICDQWDALGSLTHSRRlight4+479.48641913.91661320.5015 
TEKQLEAIDQLHLEYAK12028.0528 TEKQLEAIDQLHLEYAKlight3+677.02492028.05281328.0079 
TEKQLEAIDQLHLEYAK12028.0528 TEKQLEAIDQLHLEYAKlight4+508.02052028.05281321.5858 
TEKQLEAIDQLHLEYAKR22184.1539 TEKQLEAIDQLHLEYAKRlight4+547.04572184.15391323.0687 
TEKQLEAIDQLHLEYAKR22184.1539 TEKQLEAIDQLHLEYAKRlight5+437.83812184.15391318.9188 
QLEAIDQLHLEYAK01669.8675 QLEAIDQLHLEYAKlight2+835.94101669.86751327.9832 
QLEAIDQLHLEYAK01669.8675 QLEAIDQLHLEYAKlight3+557.62981669.86751323.4709 
QLEAIDQLHLEYAKR11825.9686 QLEAIDQLHLEYAKRlight2+913.99161825.96861330.3247 
QLEAIDQLHLEYAKR11825.9686 QLEAIDQLHLEYAKRlight3+609.66351825.96861325.4482 
QLEAIDQLHLEYAKR11825.9686 QLEAIDQLHLEYAKRlight4+457.49941825.96861319.6660 
STLPDADR0873.4192 STLPDADRlight2+437.7169873.41921216.0365 
EAILAIHK0893.5335 EAILAIHKlight2+447.7740893.53351316.3382 
IAESNHIKLSGSNPYTTVTPQIINSK12811.4767 IAESNHIKLSGSNPYTTVTPQIINSKlight4+703.87642811.47671329.0283 
IAESNHIKLSGSNPYTTVTPQIINSKWEK23254.6935 IAESNHIKLSGSNPYTTVTPQIINSKWEKlight5+651.94603254.69351327.0549 
IAESNHIK0910.4872 IAESNHIKlight2+456.2509910.48721316.5925 
LSGSNPYTTVTPQIINSK01919.0000 LSGSNPYTTVTPQIINSKlight2+960.50731919.00001331.7202 
LSGSNPYTTVTPQIINSK01919.0000 LSGSNPYTTVTPQIINSKlight3+640.67391919.00001326.6266 
LSGSNPYTTVTPQIINSKWEK12362.2169 LSGSNPYTTVTPQIINSKWEKlight3+788.41292362.21691332.2407 
VQQLVPK0810.4963 VQQLVPKlight2+406.2554810.49631315.0927 
RDHALLEEQSKQQSNEHLR22317.1523 RDHALLEEQSKQQSNEHLRlight4+580.29542317.15231324.3322 
RDHALLEEQSKQQSNEHLR22317.1523 RDHALLEEQSKQQSNEHLRlight5+464.43772317.15231319.9296 
RDHALLEEQSK11324.6735 RDHALLEEQSKlight2+663.34401324.67351322.8053 
RDHALLEEQSK11324.6735 RDHALLEEQSKlight3+442.56511324.67351319.0985 
DHALLEEQSKQQSNEHLRR22317.1523 DHALLEEQSKQQSNEHLRRlight4+580.29542317.15231324.3322 
DHALLEEQSKQQSNEHLRR22317.1523 DHALLEEQSKQQSNEHLRRlight5+464.43772317.15231319.9296 
DHALLEEQSKQQSNEHLR12161.0512 DHALLEEQSKQQSNEHLRlight4+541.27012161.05121322.8493 
DHALLEEQSK01168.5724 DHALLEEQSKlight2+585.29351168.57241320.4638 
QQSNEHLR01010.4894 QQSNEHLRlight2+506.25201010.48941318.0926 
RQFASQANVVGPWIQTK11929.0221 RQFASQANVVGPWIQTKlight3+644.01461929.02211326.7536 
QFASQANVVGPWIQTK01772.9210 QFASQANVVGPWIQTKlight2+887.46781772.92101329.5290 
QFASQANVVGPWIQTK01772.9210 QFASQANVVGPWIQTKlight3+591.98091772.92101324.7763 
ISIEMNGTLEDQLSHLKQYER12503.2377 ISIEMNGTLEDQLSHLKQYERlight3+835.41982503.23771334.0270 
ISIEMNGTLEDQLSHLKQYER12503.2377 ISIEMNGTLEDQLSHLKQYERlight4+626.81672503.23771326.1000 
ISIEMNGTLEDQLSHLK01942.9670 ISIEMNGTLEDQLSHLKlight3+648.66291942.96701326.9302 
ISIEMNGTLEDQLSHLK01926.9721 ISIEMNGTLEDQLSHLKlight2+964.49331926.97211331.8398 
ISIEMNGTLEDQLSHLK01926.9721 ISIEMNGTLEDQLSHLKlight3+643.33131926.97211326.7276 
SIVDYKPNLDLLEQQHQLIQEALIFDNK03323.7402 SIVDYKPNLDLLEQQHQLIQEALIFDNKlight3+1108.92073323.74021344.4200 
SIVDYKPNLDLLEQQHQLIQEALIFDNK03323.7402 SIVDYKPNLDLLEQQHQLIQEALIFDNKlight4+831.94233323.74021333.8948 
SIVDYKPNLDLLEQQHQLIQEALIFDNK03323.7402 SIVDYKPNLDLLEQQHQLIQEALIFDNKlight5+665.75533323.74021327.5797 
PNLDLLEQQHQLIQEALIFDNK02618.3704 PNLDLLEQQHQLIQEALIFDNKlight3+873.79742618.37041335.4853 
PNLDLLEQQHQLIQEALIFDNK02618.3704 PNLDLLEQQHQLIQEALIFDNKlight4+655.59992618.37041327.1938 
HTNYTMEHIR01316.5932 HTNYTMEHIRlight2+659.30391316.59321322.6841 
HTNYTMEHIR01316.5932 HTNYTMEHIRlight3+439.87171316.59321318.9961 
HTNYTMEHIR01300.5983 HTNYTMEHIRlight2+651.30641300.59831322.4442 
HTNYTMEHIR01300.5983 HTNYTMEHIRlight3+434.54001300.59831318.7935 
VGWEQLLTTIAR01385.7667 VGWEQLLTTIARlight2+693.89061385.76671323.7217 
VGWEQLLTTIAR01385.7667 VGWEQLLTTIARlight3+462.92951385.76671319.8723 
TINEVENQILTR01428.7573 TINEVENQILTRlight2+715.38591428.75731324.3666 
TINEVENQILTR01428.7573 TINEVENQILTRlight3+477.25971428.75731320.4169 
GISQEQMQEFR01351.6190 GISQEQMQEFRlight2+676.81681351.61901323.2095 
GISQEQMQEFR01351.6190 GISQEQMQEFRlight3+451.54701351.61901319.4398 
GISQEQMQEFR01367.6140 GISQEQMQEFRlight2+684.81431367.61401323.4494 
ASFNHFDK0964.4403 ASFNHFDKlight2+483.2274964.44031317.4018 
ASFNHFDKDHGGALGPEEFK12202.0130 ASFNHFDKDHGGALGPEEFKlight3+735.01162202.01301330.2114 
ASFNHFDKDHGGALGPEEFK12202.0130 ASFNHFDKDHGGALGPEEFKlight4+551.51052202.01301323.2384 
ASFNHFDKDHGGALGPEEFK12202.0130 ASFNHFDKDHGGALGPEEFKlight5+441.40992202.01301319.0546 
DHGGALGPEEFK01255.5833 DHGGALGPEEFKlight2+628.79891255.58331321.7690 
DHGGALGPEEFK01255.5833 DHGGALGPEEFKlight3+419.53501255.58331318.2233 
ACLISLGYDVENDRQGEAEFNR12555.1711 ACLISLGYDVENDRQGEAEFNRlight3+852.73102555.17111334.6848 
ACLISLGYDVENDRQGEAEFNR12555.1711 ACLISLGYDVENDRQGEAEFNRlight4+639.80002555.17111326.5934 
ACLISLGYDVENDR01623.7563 ACLISLGYDVENDRlight2+812.88541623.75631327.2916 
ACLISLGYDVENDR01623.7563 ACLISLGYDVENDRlight3+542.25941623.75631322.8869 
QGEAEFNR0949.4254 QGEAEFNRlight2+475.7200949.42541317.1766 
IMSLVDPNHSGLVTFQAFIDFMSR02724.3404 IMSLVDPNHSGLVTFQAFIDFMSRlight3+909.12072724.34041336.8276 
IMSLVDPNHSGLVTFQAFIDFMSR02724.3404 IMSLVDPNHSGLVTFQAFIDFMSRlight4+682.09242724.34041328.2005 
IMSLVDPNHSGLVTFQAFIDFMSR02740.3353 IMSLVDPNHSGLVTFQAFIDFMSRlight3+914.45242740.33531337.0302 
ETTDTDTADQVIASFK01740.8054 ETTDTDTADQVIASFKlight2+871.41001740.80541329.0473 
ETTDTDTADQVIASFK01740.8054 ETTDTDTADQVIASFKlight3+581.27571740.80541324.3695 
VLAGDKNFITAEELR11674.8941 VLAGDKNFITAEELRlight2+838.45431674.89411328.0586 
VLAGDKNFITAEELR