Protein / Label:sp|P02763|A1AG1_HUMAN
Description:Alpha-1-acid glycoprotein 1 OS=Homo sapiens GN=ORM1 PE=1 SV=1
Decoy:false
Note: 
File:ORM1_20151216_2016-02-08_08-49-36.sky.zip
0102030405060708090
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQ
1 1 1 1 >>
100110120130140150160170180190
RENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGE
> 1 1 1 1 1 1
200
S
DescriptionAlpha-1-acid glycoprotein 1 (short name: AGP 1)
Gene name(s)ORM1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000598.2
none loaded Q8TC16
Q5U067
Q5T539
P02763
B7ZKQ5
A1AG1_HUMAN
ENST00000259396
none loaded GO:0006953
GO:0006810
GO:0005615
GO:0002682

Peak Areas

Retention Times